KEGG   Tetrahymena thermophila: TTHERM_00086830Help
Entry
TTHERM_00086830   CDS       T01020                                 

Definition
Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tet  Tetrahymena thermophila
Brite
Enzymes [BR:tet01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     TTHERM_00086830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 408 aa AA seqDB search
MSFISRAFNKGSKLALAHLMKQRNIVFPVCFNFSQLQSKNFVMKKTELSNDLLISLSMGF
EHKEATNQKELTQNLIINNVLKDKVVQDVFNELDRDLFAINKSQKIYANNPLSIGKGQNM
TSPLMHAIALQEIYERLMILLKQKKGSEIKILDIGCGRGYIAFAISKIIEKCDDLKDIKV
FVKGIDIYEDLTYGANEILHKLNINKNITFQFDTLNIEQEIQNKQQVYDIIHSGVALELS
VYNNMIGQIYAQNQEGSCIICPVIQEDLEQNLYLRCNNQEHVVMKCVYSQMITLKQQEIS
KYFLEDGEIAEEDSTSTLQAQSQQSQEEMNLELLENTKLKREQHKVEQQLSQKEAQLKQY
FENFKKNNNGIAPNLKEMNSNEETKQLLNEISHLKKQLKIVKAKQQIK
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagttttattagtagagctttcaacaagggatcaaagctagctttagcacatttgatg
aaataaagaaatattgtttttccagtatgttttaatttcagtcaactatagagcaaaaat
tttgttatgaaaaaaacagaattaagcaatgatttactgatttctttatcaatgggattt
gaacacaaagaagctactaaccaaaaagagttaacatagaatttgattattaataatgtc
ttaaaggataaagttgtataagatgtatttaatgagctagatagagatttatttgctatc
aacaagagctaaaagatttatgctaacaatccattatcgataggaaaaggtcaaaacatg
acttcgcctttaatgcacgctattgctttgtaagagatatatgagagattaatgatctta
ttaaagtaaaaaaaaggttctgaaataaaaattttagatattggttgcggaagaggatac
attgcatttgccatttcaaagattattgaaaaatgtgatgatttaaaagatattaaagta
tttgtaaaaggtattgatatttacgaagatttaacatatggtgcaaatgagattcttcat
aaattaaatatcaacaaaaatattaccttccaatttgatactttaaatatcgaataggaa
atacaaaacaaatagtaagtttatgatattatacattcaggagttgctctagaattaagc
gtttacaataatatgataggctaaatttatgcttaaaatcaagaaggttcttgtattatt
tgtcctgtcatttaagaagatttagagtagaatttatatttgagatgcaataactaggaa
catgttgttatgaaatgtgtttattcttaaatgattacacttaaatagtaggaaataagc
aaatattttttggaagatggagaaattgctgaagaagattcaacttctactttataagct
taatctcagtaaagctaagaagaaatgaatctagagttattagaaaatactaaattaaaa
agagaatagcataaagttgagcaacaattatcataaaaagaggcacagttgaagcaatat
ttcgaaaatttcaaaaaaaataataatggcattgctcctaatttaaaagaaatgaatagt
aacgaagaaacaaagtaattactcaatgaaatatcacatcttaaaaaacaattaaaaata
gtaaaagctaagtaatagataaaatga

DBGET integrated database retrieval system