KEGG   Tetrahymena thermophila: TTHERM_00101230Help
Entry
TTHERM_00101230   CDS       T01020                                 

Definition
Ubiquitin carboxyl-terminal hydrolase family protein (EC:3.1.2.15)
Organism
tet  Tetrahymena thermophila
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
AA seq 851 aa AA seqDB search
MEGQQQDQKLQEEAFKTDQMNQAEQISDQQNQQGCEQDLEEANYVGLSNIGATCYMNSVL
QTLFMTPEFRENIYQWKYDSDDSQAEDCIPLQLQILFAKMQLRSFPYVDTKDLAKSFGWD
NQDGWEQHDTQEFVRILLDAIEKSVHGSKNYNFINDIYEGTSANYVKCMECNYESITQEN
FLDLVVTVKNIYDKIYNDSLEKAVQRYIKPETLDNDNKYMCSKCNKKVKALRGTRFCKLP
KILSFIMNRFTFDFSDMKRLKLDDYVSFPFVLNMNEYINGYDNIKNKLSEEVDPSYFKSD
YTIKPPVNKTKIGLTTTKTAKISSVTTQIKKKVPIKSASNQTRDFLKNLRTQKKFQTDEA
AGGINSNGSSQQGMFIEFDQNSIDKQQDAELQKAIQLSLIESQIHEKTGESKESGNNQNN
SSAETADTLTDSQNHLNFNPAGPSPDPLQNKKQLCGAGVAQVVSDFQNIQMQDNVIQEEE
QKCNSQIVEENFNEENEGQLTPNGKSSSLINQKGINLSNSKASSSRINRHLSNKKPSTIQ
QGSSNTITSSTNQGQQREHSTNKRDQEEKNKQDYKKILAEHLQKNTQDCNQLIEKYLKDG
PLVYELYSILIHSGGAYGGHYYAYIKAFEDGGKWHSFNDTSIMEIDVNEIQERVFGGNST
NAYMLFYRQWEPPQRRKLKIDNLLIPKNVIDIIEVQKNKWVEEQNWKLEQSKMMSVKVHY
ILNVKVIQVKSTDTLSKVLDSVIQEFKIKEKRENIRLRRYKPNTDQMLDTFEELEHLSLD
KLKINHFTNLCVEVKKDGEQFEEYDAGTTFVKMAVWKPNIISLDENYLDSFNQEKCNYLQ
INGVACKGCKY
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atggaaggttagtaataggattagaagctttaggaagaagcatttaagacagattagatg
aattaagcagaataaatttcagactaatagaactagcaaggctgcgaataggatttagaa
gaagcaaattatgttgggctttctaacattggagcgacatgttatatgaatagtgtgtta
tagactctatttatgactccagagttcagagaaaatatatattaatggaaatatgattca
gacgattcgtaggcagaagactgtattcctttataattgtagattttatttgctaaaatg
cagttaaggtcttttccatacgtagatacaaaggatttagccaaaagctttggctgggat
aattaggatggatgggaatagcatgacacttaagaatttgttagaatacttttagatgca
atagaaaagagtgttcatggaagcaaaaattataattttataaatgacatatatgaagga
acttcagccaattatgtcaagtgcatggaatgcaattatgaaagcataacacaagaaaat
tttttggatttagttgtcactgtcaaaaatatttatgacaaaatatacaatgattcactc
gaaaaagcagtttagcgttacatcaagcctgagaccctggataatgataataagtatatg
tgctctaaatgcaataaaaaagttaaagcactgcgtggtactaggttctgtaagctacca
aaaattctcagctttattatgaatagatttacttttgatttttctgatatgaagagatta
aaattagatgattatgtgagttttccttttgtgctgaatatgaatgaatatataaacgga
tacgacaatatcaaaaataaactcagcgaagaagttgatccttcttatttcaaaagtgat
tatactataaagcctcctgtaaataaaacaaaaattggtttaacaacaactaaaactgct
aaaattagcagtgttactacttaaattaaaaaaaaagtacctattaaatctgcatctaat
tagacaagagattttttaaagaatttaagaacccaaaagaaattttaaactgatgaagct
gcaggcggaataaattcaaatggaagttcataacaaggaatgtttattgaatttgattag
aatagtattgataaataataagatgcagaattgcaaaaagccatacaactttctctaatt
gaatcacaaatacatgaaaaaactggagagagcaaggagagtggaaacaatcaaaataat
tcttctgctgaaacagccgatactctcacagatagttaaaatcatttaaattttaatcct
gctggtccttctcctgatcctttgtaaaataaaaagcaattatgtggagctggagttgcc
taagttgtctcagacttttaaaatatttaaatgcaagataatgtgatataagaagaagaa
tagaagtgtaattcttagatagtagaggaaaattttaatgaagaaaatgaaggacaatta
actccaaatggaaagtcaagcagtttaataaattaaaaaggtatcaatttatccaactca
aaagcttctagctctaggataaataggcatctctcaaataaaaagccatctacaatttaa
taaggatcttcaaatactataacttcatctactaattaaggacaataaagagaacacagt
actaataaacgagatcaagaggaaaagaataaataggattacaaaaaaatattggcagag
cacttgtaaaaaaatacctaagattgcaatcagctgatagaaaaatatttaaaagatggc
cctctcgtttatgagctctattcaatattaatccattcaggaggtgcatatggaggtcac
tactatgcatatattaaagcttttgaagatggtggaaagtggcattcttttaatgacaca
tcaatcatggaaatagatgtcaacgaaatacaagaaagagtatttggtggaaattcaact
aatgcttacatgttattttacagatagtgggaaccaccataaagaaggaaattaaagata
gataatttactgattcctaaaaacgtaatagatattattgaagtgcaaaagaacaaatgg
gttgaagaataaaactggaaattagaacagtctaaaatgatgtcagttaaagttcactac
attttaaatgtcaaagttattcaagtgaaatcaactgatacgctctcaaaagtactcgat
tcagtcatttaagagtttaaaatcaaagaaaagagagaaaacattagactaagaagatac
aagccaaatacagattagatgctagacacttttgaagagctggaacatttgagcttagat
aagctaaagattaaccattttactaatttatgtgttgaagttaaaaaagatggagaacag
ttcgaagaatatgacgctggcactacttttgttaaaatggcagtttggaagcctaatatt
atttctcttgatgaaaattatttggatagtttcaactaggagaaatgcaactatttatag
attaatggagtagcttgcaagggctgcaaatattga

DBGET integrated database retrieval system