KEGG   Tetrahymena thermophila: TTHERM_00105450Help
Entry
TTHERM_00105450   CDS       T01020                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase family protein (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tet  Tetrahymena thermophila
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tet01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tet00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:tet00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 564 aa AA seqDB search
MDQTLCHTIQNNCTQLICDLHAYCIETDRQADKRSLNQRCIKIELGKEKKIKLISKQINK
IKRKEKINLQKQQLNKIRRKKNLLKIKASKKMRSAIKKLLPLVQLTKTMPKYSLVTVNAK
NSMKIKQFQSQYLLTHTSKANFAIKTINVPSMGDSITEGQVHQMLKKVGDYVELDEVVCS
VETDKTQVPIRSPEAGVITELFAQEGENVNVGKPFFVLDTDGKKPEGAAKPAAAAAGAKK
EEAPKKAEAAKPAASTPAPEAAKKTEAPKAASSSAASQKPTQMAIPAGLFQNKSKKKQIV
NQFSQNKQSNQKASSNQVSKQANISSQWGEKNRTETRQPLSKMRQRIGQRLKDSQNTYAL
LPTFNEVDMSNVMEIRNKYQEQFQKKHNVKLGFMSFFVKAATAALQQQPIVNAVIDGKEI
VYRNYVDISVAVATPTGLMVPVLRNTENMSFADVEREIIRLGNKGKEGSITVEDMVGGTF
TISNGGTYGSLFGMPILNPPQSAILGMHAVQNRPVVRGDQIVARPMMYLALTYDHRLIDG
REAVTFLKTIKEIVEEPSKLLFEI
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggattaaacactttgtcacactatctaaaataattgcacatagttaatatgtgatttg
catgcttattgcatagagacagacagataggcagataaacgttcacttaattagagatgc
atcaaaatagagctaggaaaagaaaagaaaataaaattaataagcaagcaaataaataaa
ataaaaagaaaagaaaagataaaccttcaaaaacaataattaaataaaataagaagaaaa
aaaaatcttttaaaaataaaagcatcgaaaaaaatgagatctgccatcaagaaattattg
cccttagtttaattaaccaagaccatgcccaagtactccttggtcactgtcaatgctaag
aatagcatgaaaatcaagcaattctagagctaatatctccttactcacactagcaaggct
aatttcgcaattaagactatcaatgttccttctatgggtgactccatcactgaaggtcaa
gttcactaaatgttgaagaaggttggtgattatgttgaattagacgaagtcgtttgcagc
gtcgaaaccgacaagacccaagtaccaattcgttctcctgaagctggtgttatcactgaa
ttatttgcctaagaaggtgaaaacgttaatgtaggaaagcccttctttgtccttgatact
gatggtaaaaagcctgaaggtgctgctaagccagctgctgccgctgctggagctaaaaag
gaagaagctcctaagaaagctgaagctgctaagcctgctgcctccacccctgctcctgaa
gctgctaaaaagactgaagcccctaaggctgcttcctcttctgctgcttcccaaaaaccc
actcaaatggctatcccagctggtttattttaaaacaaaagcaaaaaaaaataaattgta
aattagttttcgtaaaataaacaatcaaactaaaaagcaagttccaattaagtaagtaag
caagcaaacatctcaagctaatggggagaaaagaatagaactgaaactagacaaccctta
tccaagatgagacaaagaatcggttaaagacttaaagactcttagaatacatacgcttta
cttcctactttcaacgaagttgatatgagcaacgtcatggaaataagaaataaatactaa
gaacaattccaaaagaaacacaacgttaagcttggtttcatgtctttcttcgttaaggct
gctactgctgctctccaataataacctatcgttaatgcagttattgatggaaaggaaatt
gtttatagaaactacgttgatatttcagttgccgttgccacccctactggtttaatggtt
cccgttcttagaaataccgaaaatatgtcttttgctgacgttgaaagggaaattatccgt
ttaggaaataaaggtaaggaaggatccattaccgttgaagatatggtcggtggtactttc
actatttctaatggtggtacttacggttctttgttcggtatgcccatcttgaaccctcct
caatcagctattttgggtatgcacgctgtctaaaacagacccgttgttagaggtgaccaa
atcgttgctagacctatgatgtacttagctttaacttatgatcacagacttattgacggt
agagaggctgttaccttcttaaaaactatcaaggaaatagtcgaagaaccctctaagctg
ttatttgaaatttga

DBGET integrated database retrieval system