KEGG   Tetrahymena thermophila: TTHERM_00105450Help
Entry
TTHERM_00105450   CDS       T01020                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase complex protein, putative
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tet  Tetrahymena thermophila
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TTHERM_00105450
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TTHERM_00105450
  Amino acid metabolism
   00310 Lysine degradation
    TTHERM_00105450
Enzymes [BR:tet01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     TTHERM_00105450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 432 aa AA seqDB search
MRSAIKKLLPLVQLTKTMPKYSLVTVNAKNSMKIKQFQSQYLLTHTSKANFAIKTINVPS
MGDSITEGQVHQMLKKVGDYVELDEVVCSVETDKTQVPIRSPEAGVITELFAQEGENVNV
GKPFFVLDTDGKKPEGAAKPAAAAAGAKKEEAPKKAEAAKPAASTPAPEAAKKTEAPKAA
SSSAASQKPTQMAIQWGEKNRTETRQPLSKMRQRIGQRLKDSQNTYALLPTFNEVDMSNV
MEIRNKYQEQFQKKHNVKLGFMSFFVKAATAALQQQPIVNAVIDGKEIVYRNYVDISVAV
ATPTGLMVPVLRNTENMSFADVEREIIRLGNKGKEGSITVEDMVGGTFTISNGGTYGSLF
GMPILNPPQSAILGMHAVQNRPVVRGDQIVARPMMYLALTYDHRLIDGREAVTFLKTIKE
IVEEPSKLLFEI
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgagatctgccatcaagaaattattgcccttagtttaattaaccaagaccatgcccaag
tactccttggtcactgtcaatgctaagaatagcatgaaaatcaagcaattctagagctaa
tatctccttactcacactagcaaggctaatttcgcaattaagactatcaatgttccttct
atgggtgactccatcactgaaggtcaagttcactaaatgttgaagaaggttggtgattat
gttgaattagacgaagtcgtttgcagcgtcgaaaccgacaagacccaagtaccaattcgt
tctcctgaagctggtgttatcactgaattatttgcctaagaaggtgaaaacgttaatgta
ggaaagcccttctttgtccttgatactgatggtaaaaagcctgaaggtgctgctaagcca
gctgctgccgctgctggagctaaaaaggaagaagctcctaagaaagctgaagctgctaag
cctgctgcctccacccctgctcctgaagctgctaaaaagactgaagcccctaaggctgct
tcctcttctgctgcttcccaaaaacccactcaaatggctatccaatggggagaaaagaat
agaactgaaactagacaacccttatccaagatgagacaaagaatcggttaaagacttaaa
gactcttagaatacatacgctttacttcctactttcaacgaagttgatatgagcaacgtc
atggaaataagaaataaatactaagaacaattccaaaagaaacacaacgttaagcttggt
ttcatgtctttcttcgttaaggctgctactgctgctctccaataataacctatcgttaat
gcagttattgatggaaaggaaattgtttatagaaactacgttgatatttcagttgccgtt
gccacccctactggtttaatggttcccgttcttagaaataccgaaaatatgtcttttgct
gacgttgaaagggaaattatccgtttaggaaataaaggtaaggaaggatccattaccgtt
gaagatatggtcggtggtactttcactatttctaatggtggtacttacggttctttgttc
ggtatgcccatcttgaaccctcctcaatcagctattttgggtatgcacgctgtctaaaac
agacccgttgttagaggtgaccaaatcgttgctagacctatgatgtacttagctttaact
tatgatcacagacttattgacggtagagaggctgttaccttcttaaaaactatcaaggaa
atagtcgaagaaccctctaagctgttatttgaaatttga

DBGET integrated database retrieval system