KEGG   Tetrahymena thermophila: TTHERM_00105450Help
Entry
TTHERM_00105450   CDS       T01020                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase complex protein, putative
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tet  Tetrahymena thermophila
Pathway
tet00020  Citrate cycle (TCA cycle)
tet00310  Lysine degradation
tet01100  Metabolic pathways
tet01110  Biosynthesis of secondary metabolites
tet01130  Biosynthesis of antibiotics
tet01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TTHERM_00105450
  Amino acid metabolism
   00310 Lysine degradation
    TTHERM_00105450
Enzymes [BR:tet01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     TTHERM_00105450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_D23 GCV_H HlyD_3
Motif
Other DBs
NCBI-GeneID: 7828158
NCBI-ProteinID: XP_001012295
TGD: TTHERM_00105450
UniProt: Q234F3
AA seq 432 aa AA seqDB search
MRSAIKKLLPLVQLTKTMPKYSLVTVNAKNSMKIKQFQSQYLLTHTSKANFAIKTINVPS
MGDSITEGQVHQMLKKVGDYVELDEVVCSVETDKTQVPIRSPEAGVITELFAQEGENVNV
GKPFFVLDTDGKKPEGAAKPAAAAAGAKKEEAPKKAEAAKPAASTPAPEAAKKTEAPKAA
SSSAASQKPTQMAIQWGEKNRTETRQPLSKMRQRIGQRLKDSQNTYALLPTFNEVDMSNV
MEIRNKYQEQFQKKHNVKLGFMSFFVKAATAALQQQPIVNAVIDGKEIVYRNYVDISVAV
ATPTGLMVPVLRNTENMSFADVEREIIRLGNKGKEGSITVEDMVGGTFTISNGGTYGSLF
GMPILNPPQSAILGMHAVQNRPVVRGDQIVARPMMYLALTYDHRLIDGREAVTFLKTIKE
IVEEPSKLLFEI
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgagatctgccatcaagaaattattgcccttagtttaattaaccaagaccatgcccaag
tactccttggtcactgtcaatgctaagaatagcatgaaaatcaagcaattctagagctaa
tatctccttactcacactagcaaggctaatttcgcaattaagactatcaatgttccttct
atgggtgactccatcactgaaggtcaagttcactaaatgttgaagaaggttggtgattat
gttgaattagacgaagtcgtttgcagcgtcgaaaccgacaagacccaagtaccaattcgt
tctcctgaagctggtgttatcactgaattatttgcctaagaaggtgaaaacgttaatgta
ggaaagcccttctttgtccttgatactgatggtaaaaagcctgaaggtgctgctaagcca
gctgctgccgctgctggagctaaaaaggaagaagctcctaagaaagctgaagctgctaag
cctgctgcctccacccctgctcctgaagctgctaaaaagactgaagcccctaaggctgct
tcctcttctgctgcttcccaaaaacccactcaaatggctatccaatggggagaaaagaat
agaactgaaactagacaacccttatccaagatgagacaaagaatcggttaaagacttaaa
gactcttagaatacatacgctttacttcctactttcaacgaagttgatatgagcaacgtc
atggaaataagaaataaatactaagaacaattccaaaagaaacacaacgttaagcttggt
ttcatgtctttcttcgttaaggctgctactgctgctctccaataataacctatcgttaat
gcagttattgatggaaaggaaattgtttatagaaactacgttgatatttcagttgccgtt
gccacccctactggtttaatggttcccgttcttagaaataccgaaaatatgtcttttgct
gacgttgaaagggaaattatccgtttaggaaataaaggtaaggaaggatccattaccgtt
gaagatatggtcggtggtactttcactatttctaatggtggtacttacggttctttgttc
ggtatgcccatcttgaaccctcctcaatcagctattttgggtatgcacgctgtctaaaac
agacccgttgttagaggtgaccaaatcgttgctagacctatgatgtacttagctttaact
tatgatcacagacttattgacggtagagaggctgttaccttcttaaaaactatcaaggaa
atagtcgaagaaccctctaagctgttatttgaaatttga

DBGET integrated database retrieval system