KEGG   Tetrahymena thermophila: TTHERM_00128330Help
Entry
TTHERM_00128330   CDS       T01020                                 

Definition
(RefSeq) amylo-alpha-1,6-glucosidase family protein
  KO
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
tet  Tetrahymena thermophila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TTHERM_00128330
Enzymes [BR:tet01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     TTHERM_00128330
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     TTHERM_00128330
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 1562 aa AA seqDB search
MKKQSSSSEKFQKDRELWLTNNAQEDITLSSFSKNVDKVKQNNYRQNGLVTGTIFFNETS
AQKQLQNQINQNMVKNCQLNQNASPSSYVFQKKQNKLEEEIIKNGVRTSISSSENQQDQD
DTIRNIVHKVEIDSEGIIQEKTYKQVIDQQIQRENHLKNLQNKYRQNHIKVEDNEDEKSS
LKLLKSAQFNKITESDNCKTQNKMQVKSKAQQDLQLNYSYVSFDDNGENFMTNQTEEQSE
FNTKQSCNNKNKFSSISSSSTGIYQKKIEEVQQELKEKISFLIALEEELLETKTQLNMQK
LENSSHKERINKLQKDNHLMQKQITQMGETIKNLEKASNSLVNQILLIKNNNEFNVSKEH
QSSVNNLNDSCVNSLANYQEYLNDIVKSNINLRISLEELNQKYGQLKSQINSTVFTHSSP
VSTRTQNLQLESTLSTNKYRSSFLKDMQDSLECRRSVSPSNISSKSRTSMSPIQGGMNIE
EFEKNLSYSKQQAQFSLQGRVREIKDSCDKFVNKYLKNKRRNCSDEKERQFFVELDNEFQ
LINNNIQKMESYLEEVKFENESRVKNARQQFETTLKEIEQIKKIAEERNKILIDQVKQIE
QQNISLNKTVENYKGSLMENEKGLDESRLKLETYQKSTEDYQIMLKQVNETLALKNEELV
QMKVYRDNLEQDLNQKVLNIKELKLENNENSQFIRKLQEQIIALQKEIQDKQEALSKSQE
FAQQLREETERKASSIQRDNYQIQNKEKEFLEKEIKFKERENQLLNELSQRDQIISNLQD
QINELNQSHLINKIESENQCLKTELDNLKQIKSEFENNFNILQTQITALKSENKELKNDE
VERKLLQYEKYIQLEQKLGLQQTDILLLVEKLPLAEQELQNIVALNEKLQNEISKLKQEK
TDSEKGQKDWKSKYEKSNQEVKHIQEQFNQERDLLKENIKQQVQMNQQLQKQNQTIMKNC
EITKQGQINLETQIKNLTEENELLSQKCIKLEDCLQLLVKERELIKKQQNENKLKELSSS
EQNVIQSIGSASQKQVLQKNPQKNDKKDQLRISTSKDQVNHVERLQTSVSPSNSRSSKQS
TKVIKNLNQNSSNGSANNNLNQANNTKQINQQPVSSSITKQKQSQNSQILSNSIQSQSSA
KSFINTNRSQQQLTSSQQIKQMQQFHAMQGIQQHQLASLSPMSQQKYQQANNQSIQSNSS
GKNSNLALQSISPKNILRSQELKSKQFTEKENNSCLQQEQSIKISQLIQSNQFNNNSNSL
IQSLSGNSFTPNNKNSNNFNGPQNLLNSQHFRQTNQNSNCEYAKENSNRILNTNQLSNYQ
QDDENQENQKYFAQENENTYNVEESGTIYTNRIQEKPSYSHNEDCKITSDEGYSNTMHTI
NFYEDSNNQQWKIKSLRDHPYEIVKKNDKNMNQTFAEADQYEDFEERKDFDPIQQQQQER
FEREINLREQEQRELFQNKLNDQKYTQHHQNNNQIQDIEQNQIWNEQQIRQDLQQKDTFE
NQSENDSYQQQLLEQGQQQIRQIHEGFSFNNEMQRGKFMFQQQLNNINFSDEAFQTEQYS
FN
NT seq 4689 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcagtcatcatcatcagaaaaattctaaaaagatagagaattatggctgaca
aacaatgcttaagaggatattactctaagcagttttagtaaaaatgtagataaagtaaaa
taaaataattatagataaaacggcttagttactgggactatattctttaatgagacttca
gcatagaaataattacaaaattagatcaattaaaacatggttaagaattgctaattgaat
tagaatgcttcgccatcaagctacgtattttaaaagaaataaaataaattagaagaagaa
atcataaaaaatggagtaagaacatcaattagtagttctgaaaattagcaggattaagat
gatactattaggaatatagttcataaagttgaaatcgactctgaaggtatcatacaagaa
aaaacatataagcaagtgattgattagcagatttaaagagaaaatcatctcaagaattta
taaaataaatacagataaaatcatattaaggtagaagataatgaagatgaaaaaagctca
cttaagttgctaaagtcagcacaatttaataaaatcacagaaagcgataattgcaaaact
taaaataaaatgtaagtcaaaagtaaagctcaataagatttgcagttaaactatagttat
gtttcctttgatgataatggagaaaattttatgaccaatcagacagaagaatagagtgaa
tttaataccaagtagagttgtaacaataaaaataagttttcttcgatttcatcatcttct
acaggcatttatcagaagaaaatagaggaggttcaataagagttaaaagaaaagataagt
tttttgattgccttagaagaggagctgcttgaaacaaaaacttagctaaatatgcaaaaa
ttagaaaattcatctcacaaagaaagaattaacaaattataaaaagacaatcatttaatg
caaaaatagataacccaaatgggtgaaacaataaagaaccttgagaaagccagcaattcg
ttagttaattaaattttgctgatcaaaaataataacgaatttaatgtcagcaaagaacat
tagagtagtgtcaataatttaaatgatagttgtgttaactctttagctaattatcaagaa
tatctaaacgatatagtaaaaagtaatataaatttaagaataagtctagaagaattaaac
taaaagtacggttagcttaaaagttaaatcaattcaacagtctttactcacagttctccc
gtttcaactagaacttaaaatctttagcttgaatcaactctcagcactaataaatacaga
agtagctttttaaaggatatgtaagatagtcttgaatgcagaagaagtgtatcaccctca
aatatctctagtaagagtagaactagtatgagtcctattcaaggaggaatgaatattgag
gaatttgaaaaaaatttgagctacagtaagtagcaagcatagtttagtttgcaaggaagg
gttagagaaataaaggattcgtgtgataagtttgtgaataaatatctcaagaataaaaga
agaaactgctctgatgaaaaagaaagatagttttttgttgaattagataacgaattttaa
ttgattaataacaatatctagaaaatggaatcttatttggaggaggttaaatttgaaaat
gaatcaagagtaaaaaatgctagataataatttgaaacaactttaaaagaaatagaataa
attaagaagattgctgaggaaagaaataaaatattaatagatcaagttaaatagattgag
caacagaatatcagtctgaataaaacagttgagaattataaaggttcgttaatggagaat
gagaagggattagatgaatcacgtcttaaattagagacttattaaaagagtactgaagat
tactaaataatgctaaaacaagttaatgagactttggcacttaaaaatgaagaactagtt
taaatgaaggtgtatagagataatctggagtaagatttaaactagaaggttttaaatatt
aaagaactaaaattagaaaacaatgagaacagctagtttattagaaaacttcaagaacaa
attatagcattataaaaggagatataagataagcaggaagctctctctaaatcttaggag
tttgcttagcagcttagagaagagactgaacgaaaagcgagctcaatttaaagagacaat
tactaaattcaaaataaagagaaagagtttcttgaaaaggaaatcaaatttaaggaaaga
gaaaattaacttctaaatgagttatctcaaagggattaaattatttctaatctacaggat
taaataaatgaattaaatcaatctcacttaattaataaaatagaatctgaaaattaatgc
cttaaaactgaattagataacctcaaataaataaaatctgaattcgagaacaattttaac
attttataaacacaaatcacagcattaaaatcagaaaacaaggaattaaaaaatgatgaa
gtagaaagaaaactattgcaatatgaaaaatatatttagcttgagcaaaagctaggttta
cagtaaactgatattttacttttggtagagaagttgcctttggctgaacaagaacttcaa
aatattgttgccttaaatgaaaaactataaaacgagataagtaaattaaaataagaaaaa
acagatagtgaaaagggataaaaagattggaaaagtaaatatgaaaagagtaattaagaa
gttaaacatatccaagaacaatttaatcaagaaagagatttgctgaaggaaaatataaag
cagcaggtacaaatgaattaacagttatagaagtagaattagacaattatgaaaaactgt
gaaatcactaagtaaggctaaattaatttagagacttaaattaagaatctaactgaagaa
aatgagctgctttcttaaaagtgcattaaacttgaagattgtttacagttattagttaag
gaaagggagctaattaagaaataatagaatgaaaataaattaaaagaactttcatcttct
gaacaaaatgtaatttagagtattggcagtgcttcttaaaaataagttctttaaaaaaat
ccataaaaaaatgataaaaaagactaattaagaatcagcacatcaaaagattaagttaat
catgttgaaagattgtaaacaagtgtttcaccatctaattcaagaagctctaagcaatca
acgaaagtgattaaaaatttaaattaaaactcttcaaatgggagtgcaaataataattta
aactaggctaacaatactaaacaaataaactagcaacctgttagcagcagcattaccaaa
tagaaacaatcccaaaatagttaaattttatccaatagcattcaaagctaatcttcagct
aaaagttttatcaatactaacagaagctaataacaattgacatcttcttaacaaattaag
taaatgcaatagtttcatgctatgcaaggtatatagcagcattagcttgcctctttaagc
cctatgtcttaataaaaatattaataagctaacaattaatcaatttaatctaactctagt
ggtaaaaacagtaatcttgccttataatcaatttcgcctaaaaatattttaagaagtcaa
gaattgaaatcaaaacaatttactgaaaaagaaaataattcctgtttgtaataggaataa
agtattaaaatttcttaactgatataaagcaattaattcaataacaatagcaacagttta
attcagtctctttctggaaattcgttcactcctaacaataagaattcaaataatttcaat
ggaccttaaaatttattaaatagttaacattttaggtaaactaattaaaacagtaactgt
gaatacgccaaagaaaattctaatagaattcttaatactaattaattaagtaattaccaa
taagatgatgaaaattaggaaaattaaaaatattttgcttaagaaaatgaaaatacctat
aatgttgaagagagtggaactatttacactaatagaatccaagaaaagccatcttactca
cataatgaagactgtaagataacatcagatgaaggatattcaaatactatgcatacaata
aacttttatgaagactcaaataattaacaatggaaaattaaatctctgagagatcaccca
tatgagatagtaaaaaagaatgataaaaatatgaaccaaacatttgcagaggctgactaa
tatgaagattttgaggagagaaaagattttgatcctatttaataacaacaataggagagg
tttgagagagagattaatctaagagaacaagagcaaagagagcttttctaaaacaaattg
aatgattaaaaatatacccagcatcatcaaaataataattaaatttaggatattgaataa
aattaaatttggaatgagtaataaattagataagatttataataaaaagatacgttcgaa
aattaatcagaaaacgacagctattaatagtaattgctcgaataaggttaatagtaaata
agatagatccatgaaggtttcagttttaataacgaaatgtaacgtggcaaattcatgttc
tagcaataacttaataatatcaattttagtgatgaagcattctaaacagaacagtattct
tttaattga

DBGET integrated database retrieval system