KEGG   Tetrahymena thermophila: TTHERM_00133500Help
Entry
TTHERM_00133500   CDS       T01020                                 

Definition
Peroxidase family protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
tet  Tetrahymena thermophila
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 293 aa AA seqDB search
MRNLLLGTLAFGTAGYYYYNKEQFTQLAKPKLDYQAVRGDIADILEQQGWDGYNHIGPVL
VRLGWHASGTYNKADKTGGSDGATMRFNKEQNDPANAGLHHAQKFLEPVKAKHPGISYAD
LWVLASYVAIEEMGGPKIDFTPGRKDAPSEASCPPNGRLPDASKGSSHIRDVFYRMGLND
REIVALIGGGHGIGKCHTDRSGYDGPWTNAPTTFTNLYFKELFDKTWTEKKWKGPLQYED
NTKKLMMLPADLEIRNDPEFKRIALEYKENKDLFFKDFASAFKKLTELGFKQF
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatcttcttcttggaactttagcattcggtactgctggttactactactacaat
aaagaatagtttacttaattagctaaacctaagcttgattatcaagctgtcagaggtgat
atagctgatatccttgaatagtaaggttgggatggctacaatcatattggccctgttctt
gttagacttggatggcatgcttcaggaacctacaacaaagctgataagactggtggttcc
gatggtgcaaccatgagatttaacaaggaatagaatgatcctgctaatgccggtcttcat
catgcccaaaagttccttgaacctgtcaaggctaaacaccctggtatttcatatgctgat
ctctgggttttggctagttacgtagctattgaagaaatgggaggtcctaaaatcgatttt
actcctggtagaaaggatgctccttcagaagcttcctgccctcctaatggcagacttcct
gatgcaagcaagggaagttctcatattagagatgttttctacagaatgggattaaatgat
agagaaattgttgctttgattggtggtggacacggtattggtaagtgccacaccgataga
agtggatatgatggtccttggactaatgcccctactactttcactaacctttactttaag
gaactcttcgataagacatggactgagaagaagtggaagggacctctctaatatgaagac
aataccaaaaagctaatgatgcttcctgctgatcttgaaataagaaatgaccctgaattt
aaaagaatcgctcttgaatataaagaaaacaaggatttattctttaaagactttgcttct
gctttcaaaaaacttacagagctcggctttaagcaattttga

DBGET integrated database retrieval system