KEGG   Tetrahymena thermophila: TTHERM_00145730Help
Entry
TTHERM_00145730   CDS       T01020                                 

Definition
MOZ/SAS family protein
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
tet  Tetrahymena thermophila
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 651 aa AA seqDB search
MAAKRKGKGKEALGKELGDKKQILNINLNQIYEGALDSNYYVIATMKNGQKAKARIIECR
ESKDFDGKKERNDYSYDYYCHFEGFNRRNDQWVTRAKIELTNELYSDQHLKKKKKGEDQK
QDKEENDEHEGMDEASLQAHMIATKVKTIERIQIGKYSCETWYYSPYPKGYHNLEALYIC
EFCLSFYITQNELDRHKKICKLTHPPGDEIYRDDTRKQSVSMFEVDGKKNQVYTENLGYL
SKLFLDHKNLYYSLDPFLIYVFCENDEEGSHIVGYFSKWKECPNGFNLSCILVLPCHQRK
GYGKFLISFSYELSLIEGKVGTPERPLSDLGRVSYLSWWSQRIIEYIKSKPADFNFSIQD
ITRETGIMEKDIIWTCEQKNMIKYAQGQVIICTDMNYLNKIYKDAGQPGVPVHPHLMRWM
PFRFKWDKEVQIATYSQQYSVDKFLQAPIEMISRVFEIKDKKIEIQQNLDYGHAGSVWDA
ALVFAHYLEKNYDKIHKQGFFNGKSILELGSGTGVAGLLTTIFNPQKVILTDMKQNQDLL
RNNVEINVKNILKSVQVENNSLEWGKENFDNLKEIIKQYQHFDIILGSDLMYDDANSLKL
LETIDELSLMIKGCVFILVYNIRKESESESEYDELYRDEDIGIIMFKAKQQ
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atggcagctaagagaaaaggaaaggggaaggaagcattaggaaaagaattaggagataaa
aagcaaatcttaaacataaatttgaattagatttatgaaggtgctcttgatagcaactat
tatgttattgcaaccatgaagaatggttaaaaagctaaagcaaggattattgaatgtaga
gaaagtaaagattttgatggaaaaaaggaaagaaacgattattcatatgattattattgt
cattttgaaggattcaataggagaaatgactaatgggtaacacgagcaaaaatagaactt
acaaatgaactatactcggattagcatcttaaaaaaaagaaaaagggagaagattagaaa
taagacaaagaagagaatgatgaacatgaaggcatggatgaggcttcactgcaggcacat
atgatagctactaaagtgaagacaatagaaagaatttaaattggaaaatactcatgtgag
acatggtattactctccttatccaaagggataccacaacttagaagctttatatatatgt
gagttttgcttaagtttttatattactcaaaatgagcttgatagacacaaaaaaatatgc
aaattaacccacccaccaggtgatgaaatttacagagatgacacaagaaaataatctgta
tctatgtttgaagttgatggtaaaaaaaattaggtatatactgaaaatcttggatatcta
agcaagcttttcttagaccataagaacctctattacagtttagatccttttttgatatat
gttttttgtgaaaacgatgaagaaggcagtcatattgttgggtatttttcaaaatggaaa
gaatgtcctaatgggtttaacttgtcctgtatattagtacttccttgtcattaaagaaaa
ggatatggcaaatttttaataagtttttcatatgaactctcacttattgagggaaaggta
ggaactccagaaagacctctctctgatttaggaagggtgagctacttgagttggtggtca
caaagaataattgaatacattaaatcaaaacccgctgattttaattttagtatataagat
ataacaagagagactggaattatggaaaaagatattatttggacttgtgaataaaaaaat
atgataaagtatgcataaggataagtcattatatgcactgacatgaattatctaaataaa
atttacaaagatgctggttaacctggagttcctgttcatcctcatttgatgagatggatg
ccatttagatttaaatgggacaaagaagtataaattgctacttattctcagtaatattct
gtagacaaatttttgtaagcacctatagaaatgatcagcagagtttttgaaattaaagat
aaaaaaatagaaatataatagaatttagattatggacatgctggttcagtttgggatgct
gcactagtttttgcacattacttagaaaaaaattatgataagatacacaagtaaggattt
tttaatggaaaatcaatactagaattgggttctgggacaggagtagctggattattaact
acaatttttaatccacagaaggttattctaactgatatgaaatagaattaggatctattg
aggaataatgttgaaataaatgtaaaaaatatcttaaaaagtgtttaagtagaaaataat
tcattagaatggggaaaggagaactttgataatttaaaagagataataaaataatattag
cattttgacataattttaggttcagatttgatgtatgatgatgctaactctttaaaatta
ctagaaacaattgatgaattaagtttgatgattaaaggttgtgtttttatattagtttat
aatatcagaaaggaatcagagagtgagtcagagtatgacgaattatatagagatgaagat
ataggaataataatgtttaaagcaaaataataatga

DBGET integrated database retrieval system