KEGG   Tetrahymena thermophila: TTHERM_00145890Help
Entry
TTHERM_00145890   CDS       T01020                                 

Definition
(RefSeq) calcineurin Ca2+binding regulatory subunit CnaB
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
tet  Tetrahymena thermophila
Brite
Protein phosphatases and associated proteins [BR:tet01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     TTHERM_00145890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8 SPARC_Ca_bdg Caleosin EF-hand_4 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 7839540
NCBI-ProteinID: XP_001011228
TGD: TTHERM_00145890
UniProt: I7LUB8
AA seq 167 aa AA seqDB search
MGNAPSENPCNFTPQEMKRLYKSFKKMDKDQSGDLEIDEFLSLPELSQNPLVRRVVSIFD
KNKDGTISFEEFVTGLSALYSDNENAKLEFAFKVYDIEDDGYISNGELFSVLKMMVGTNL
TEIQLQQLVDRTIIKADEDFDGKISFEEFKKMVKDLDVAQKLTLSPI
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacgctccaagtgaaaatccttgcaacttcactccccaagaaatgaagagactt
tacaagagtttcaagaagatggataaagactagtcaggagatttagaaatcgatgaattt
ttaagcttaccagaattgtcttaaaatcctttagttagaagagttgtatcaatttttgat
aaaaataaagatggaacaattagctttgaggaatttgtaactggactgagtgctttgtac
tcagataacgaaaatgcaaaattagaatttgctttcaaagtttatgatatcgaagatgat
ggctatatctctaacggtgagctattctctgtacttaagatgatggttggaactaatctt
acagaaatttagctttagcaattagtagatagaactattattaaggcagatgaagacttt
gatggcaaaatttcatttgaagaatttaaaaaaatggttaaggatctagatgtagctcaa
aagctaactctttcacccatatga

DBGET integrated database retrieval system