KEGG   Tetrahymena thermophila: TTHERM_00145890Help
Entry
TTHERM_00145890   CDS       T01020                                 

Definition
EF hand family protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
tet  Tetrahymena thermophila
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 167 aa AA seqDB search
MGNAPSENPCNFTPQEMKRLYKSFKKMDKDQSGDLEIDEFLSLPELSQNPLVRRVVSIFD
KNKDGTISFEEFVTGLSALYSDNENAKLEFAFKVYDIEDDGYISNGELFSVLKMMVGTNL
TEIQLQQLVDRTIIKADEDFDGKISFEEFKKMVKDLDVAQKLTLSPI
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacgctccaagtgaaaatccttgcaacttcactccccaagaaatgaagagactt
tacaagagtttcaagaagatggataaagactagtcaggagatttagaaatcgatgaattt
ttaagcttaccagaattgtcttaaaatcctttagttagaagagttgtatcaatttttgat
aaaaataaagatggaacaattagctttgaggaatttgtaactggactgagtgctttgtac
tcagataacgaaaatgcaaaattagaatttgctttcaaagtttatgatatcgaagatgat
ggctatatctctaacggtgagctattctctgtacttaagatgatggttggaactaatctt
acagaaatttagctttagcaattagtagatagaactattattaaggcagatgaagacttt
gatggcaaaatttcatttgaagaatttaaaaaaatggttaaggatctagatgtagctcaa
aagctaactctttcacccatatga

DBGET integrated database retrieval system