KEGG   Tetrahymena thermophila: TTHERM_00147600Help
Entry
TTHERM_00147600   CDS       T01020                                 

Definition
Phosphatidylinositol 3- and 4-kinase family protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
tet  Tetrahymena thermophila
Brite
Protein kinases [BR:tet01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   TTHERM_00147600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 2540 aa AA seqDB search
MSHIMQEISKLFEQFKKAKNQESERLAADLQQLYLKNNQYYDEIYHGLIKLINSNDINEK
YNSLIGIEQISYVVQEDQYLNLWSKFNSLVFQLLEQTGDEKVIKKSAEVYGRLLRLGGTR
ITNLLTDQIQKPIHWIFKNSGDNKKFSGLLVLKELLEQASFVTFKQFISNTEDYRTNLWN
LIKHKTTLLREAALSFFDVLLKQISLKEQDIQDREYNTFFTDICQSMNARQEEVVIGNIS
ALKILVTYPNSEQFNDQQFSQMCMYVLSKKDENSNIQKTVIEALPALAKFKKQAFAEKFF
IKTTEFLLQRINPPKAKSITHELIVSYYDTLNKISQCIDSTIYAKLPENMKDLVFQSIQN
ITRQIRQDLQEKKPYISFRIQCLMSIIKNFQHKYQDLINDEDLLINNILFNGLYPQSIEF
LKHIQKYNRKERTRTEVSSSIQYRLLLCIITILSKHKNLFPQSLNPNNDKDKNFYQKLIL
NTDKTLSTDEKAIANAIQTLSTFGFSNYENELANFVKDNVLDYLDNKNKNIRKAAAKAGC
LLYVKKERGQSISKNIMYEILEKFMSVAISDSEDEIRQTMLKSLNENFDQYLNEPNYLKK
LFLCVNDSNTQVQQLVLTILCRLSRYNPSDIIPFLKKTLFEFLSQLKINNLENEKQMINL
LSSLTCLIKNGPELVRPHSQSIANILLNFLKDQKITNNMIPELLKTFSQLSSLGDNTILL
YMDEIFPIFLQAMQDKSSTAKREAAVKSLVDILKYTGFVVLPYYKYPSFLEIILSLMKNE
VNVEMRQQCMRLIGCLGAIDYFYYKKVSDKVRNRLTASPSQDNRQLINDIIKVSLKKKFK
YFKKLSAAKQQESSSILTKQLHQYYEDIILLENFKQKKMYLKLSNIQAEIDYNLEGANSL
NIYQQPQKKDNRFRDQNMIEKLYSKQEIDEEIKMLLQSPTVISLTDEDYYSKITIKALLK
ILCDQSLNEHHSLAVQTLSCIIGVLQTRTKNFLDLLIPIFIKIVRQDMLRDRENILQLIQ
KIILNCGRYYDQEYLDPILNVFLEFGQDPQYYKICFSILENLIEFQKRNLRHYIEPIIRL
INNVIYKPQIDESTVLQVIKIYTLLAELLDSNLHLIVPFLCNYISKDTSQTKTKVKSEII
NLFNCFANSCCSTVQFLSLIVDSILINLEQSKDAKFINECMNTVVVFIYIHKNQFLVYLT
KLNYVVKQKNIQHIAYQKCVDIFLNNGNLDDVSSQIEPEFQKIVGEIKTDQPPQQQELFN
SLLRKIDSDKLAQVFSTSSNTSKEDWNQWIRKTSVELLNKSPNFVLTHCKELAEIYEELQ
AELFNISFVCVWSQLKDHNKTFIKEQFSKAINPENNVPINILQTILNLTEFMQHDKEGIP
IENTILGDLAERCLAYAKALYFRENEFETANIQIIESLISLYTNLGQREAAKGLLQNVQQ
QLRLDVNESWYERLHQWEYALDDYRVRQLNIPEQSFFVPKMRCLNALSDWEQLIKNTQEE
NNPEHRKQVMHLAANAAMNLGNWELLENFCDNLPEENSQDKQFWQAAISISKGQYEEAKN
LISESINKLDSQVSGLLLESYSRAYESILRLQQLFEMQEIIDIKEFEEKVNSTANREGLI
KGIQDAEIEQKRKQLRDIWADRLYGNPKDIDTWQKILSVRQLYLSKKDDLNTWLKFCRLA
LKNNQMHICKKTLEELYLEYNKDSQLMPAQLQLADLECNYQMSITKEKEICEKMEEILQS
ENKIDNKLTAKMYLKMGNWIRDKTDELNSFNMKKIGEFYQKAKDFKPDYYKTWHHFGLLN
FDAINMKQDDTIIEQKRVYIKNALEGFMRSITLGTSSEHKSPYILQDSLRLLSIIFEYGD
LEDIHNKFLEDFKQIDNRAWIEVVPQIIARLSTTKKSVQHLLHSLLTHIAQQHPQALIYP
LTVALKSKIQIRQQAASKIIENIKTHSPLLINQALLISQELNRTAILIKEQWLEGIKEAW
ERYTIDKGAHTHLIKILQGLHEMMKVPPESLSEISFHQNFGGEIFEAESWLERYKITEDA
ICLCQAFDIYYRIYSKLDVQLKKLEFVYLENVSPKLLETKNCEVSIPGLYKPTRPIVKIS
CFQPKLEVLFSKMNPRKLFVYGSDSKEYHFLLKGREDIRQDERVMQLFALINRLLHNNPE
TEKKDLNIQRYSIIPLSINTGLLGWVHNCDTLQVLIREYRKAYHIRENPEYNLMEQKCSN
YSVLPLPNKVEIFRYIMENTKGEELKKILWLKSPNSEIWLERRTNYTRSLATMSIAGYIL
GLGDRHPSNIMLQRYTGKIVHIDFGDCFEVAMRREKFPEKVPFRLTRMLVNAMEACQIEG
NYRNTCELVLKVIRENKESLIAVLEAFVYDPLFYWRLITISGEEQGDKANEKKEKGDAVY
QANKKRESRPQSLLEVSMVNQVSYVGSIIQQGTSQAIQKYIKKAQKSKINNQNDIDRAQS
PKNREKDIQEKYYNEEKEQPQENLNKKAVEVMDRIKKKLNGKDFQENESLTYTEQVSKLI
NQATSHENICQAYIGWCPFW
NT seq 7623 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatattatgcaagaaatctctaaactttttgaataattcaaaaaggctaagaat
taagagagtgagcgcttagcagccgatttgcagcagctttatttaaaaaataattaatat
tatgatgaaatttatcatgggctcattaagttaataaatagcaatgatataaatgaaaaa
tataatagtttaataggaattgaatagatatcatatgttgtgcaggaagattaatatttg
aatttatggagcaagtttaattctttagtattttagcttttagaataaacaggagatgaa
aaagttattaaaaaatcagcagaagtttatggtaggctactccgtttaggaggtactcgt
attacgaaccttctgactgattagatttaaaaacctatacattggatctttaaaaattca
ggtgataataaaaaattctctgggttgctagttttaaaggaacttctagagtaagcttct
ttcgttacattcaagcaatttataagcaatacagaagactatagaacaaatctatggaat
cttatcaaacataaaacaactcttcttagagaagcagctttgagcttttttgatgtgtta
ttaaagcaaataagtctaaaagaataggacatacaagacagagaatataacacatttttt
actgatatttgctagtctatgaatgctagataagaggaagttgttataggtaatatatct
gctctaaaaattctagttacctatcctaattctgaataattcaatgattaacagttttca
caaatgtgtatgtatgtattaagtaaaaaagatgaaaattctaatatccaaaaaactgta
attgaagctcttcccgcattagccaaatttaagaagtaagcatttgctgaaaaattcttt
ataaaaaccacagagttccttctatagcgtatcaaccctccaaaagcaaaatcaattact
catgaattaattgttagctactatgacactttaaataaaatttcatagtgtatagattct
accatatatgctaagctacctgaaaacatgaaagatctcgttttttaaagcatataaaac
ataacacgctaaatacgttaagatttacaagaaaagaagccctacatttccttcagaata
taatgcttgatgtcaatcataaagaatttttagcataaatatcaagatctcataaacgat
gaagacttactgataaacaatattctattcaatggattatatccttagagtatcgaattt
cttaaacacattcagaaatacaatagaaaagagagaacaagaacagaagtttcttcatca
atttaatatagactgcttctttgtatcatcactattctttcaaaacataaaaacttattc
cctcaaagcttaaatccgaacaatgacaaggataaaaatttctaccaaaagttaatttta
aatacagataaaacactttcaactgatgaaaaagctatagctaatgccatataaactctt
tcaacattcggctttagcaattacgaaaatgaattagcaaattttgttaaggataatgtt
ttagattatttagataataagaataaaaacatacgtaaagcagcagccaaagcaggttgc
cttttatacgtcaaaaaggagagaggatagtcgatatctaagaatattatgtatgagatt
ctagaaaaatttatgagcgttgcaatctctgactcagaagatgaaattagacaaactatg
cttaagagtttaaatgaaaattttgactaatacctaaatgaacccaactatcttaaaaaa
ttgttcttgtgtgttaatgatagcaatacataggtttaataattagttttaacaatcctt
tgcagactttcaagatataatccttctgatatcattcctttcttaaaaaagactcttttt
gaatttctgtcctaacttaaaataaataatcttgagaatgaaaagcaaatgattaatcta
ttaagttctttaacttgcttgataaaaaatggaccagagttagttagaccacactcataa
tctattgctaatattctcttgaatttcttgaaagattaaaaaataacaaataatatgatt
ccagagcttcttaaaaccttcagtcagttaagctcactcggagataatacgattttactc
tatatggatgaaatattccctattttcctataggctatgtaagacaaatcctctactgct
aagagagaagctgcagtaaaatcacttgtggatattttgaaatatactggatttgttgta
cttccatattataaatatcctagttttttggagattattctttctttgatgaagaatgaa
gtaaatgttgagatgagacaatagtgcatgagattgataggctgtctcggtgctattgat
tacttttattacaagaaagtctctgacaaagttaggaatagactcactgcttcaccttct
taagataatagataacttattaatgatatcattaaggtttccttgaaaaaaaaattcaaa
tactttaaaaagttaagcgctgcaaagtagcaagaaagctcttcaatactaactaaatag
cttcactaatattatgaagatattattttgctagaaaattttaaatagaaaaaaatgtat
ttaaaactatcaaacatataagcagagattgattacaacctagaaggcgctaatagttta
aatatatatcaatagccttaaaagaaagataacagatttagagatcaaaatatgattgag
aaattatattctaaacaagaaattgatgaagaaattaaaatgttattgcaatctccaaca
gtcatttctttaaccgatgaagactattattccaaaataactatcaaagcacttttgaaa
attttgtgcgactaatctttaaatgagcaccatagcttagcagttcaaactctaagttgc
ataataggtgtgctataaacaagaacaaaaaatttcttagatcttttaattcccatattt
attaagatagtgcgctaagatatgcttagagatcgtgaaaacatcttgcaattgattcaa
aaaataattttgaattgtggtagatattatgattaagaatatttagatccaattctcaat
gtattccttgaatttggataagatccttaatattataaaatatgcttctcaatcctcgag
aatttaattgaattttagaagagaaatcttagacattacattgagcctattatcagatta
atcaacaatgttatctataaacctcaaattgatgaatcaacagttttgcaggtcataaaa
atctacactctacttgctgagctattggactcaaatctccatctgatcgtacctttcctt
tgcaattatattagtaaagatacctcataaaccaagactaaagtaaaatcagaaatcata
aatttgtttaactgtttcgctaattcttgctgttcaacagtctaattcctttctcttatt
gtggattctattttgataaatttagaataaagcaaagatgccaagtttatcaatgagtgc
atgaacacagttgttgtttttatttacattcacaagaatcagtttttagtgtatttgaca
aagctgaattacgttgtcaaataaaaaaatatttaacacattgcataccaaaaatgtgta
gacatattcttaaataatggtaatttagacgatgtctcatcttaaatagagccagaattt
taaaaaattgttggtgaaattaaaacagactagcctccttagtagtaagagctattcaat
agtttgttaagaaagattgatagcgataaattagcttaggtcttttctacatcaagtaat
acttcaaaggaagattggaactaatggattaggaagacttcagttgagctgttaaataaa
tcaccaaactttgtattaactcactgcaaagagttagcagaaatttatgaagaactttaa
gcagagctttttaatatttcgtttgtatgtgtttggagtcagttgaaagaccacaataaa
acttttataaaagaataattctcaaaagctattaacccagagaataatgtccctatcaac
attctataaacaatccttaatttaacagaatttatgtagcatgataaagagggtatccct
attgaaaatacaattcttggtgatttagctgaaagatgtctcgcatatgcaaaggctctt
tatttcagagaaaatgaatttgaaacagcaaacatttaaattattgaaagcttaatctca
ctttatactaatttaggataaagagaagctgctaaaggtttgcttcagaatgtttaacaa
taattgagattagatgttaatgagagttggtatgaaagattgcattagtgggaatatgct
cttgatgattacagagtaagacaattaaatattccagagtagagtttctttgttcctaaa
atgaggtgccttaatgccctctcagattgggaataactaattaaaaatacttaagaagaa
aataaccctgaacacagaaagcaagttatgcatcttgctgctaatgctgccatgaattta
ggaaattgggaactacttgagaatttttgtgataacctacctgaagaaaacagctaagat
aaataattctggtaagcagctatctctatttctaaaggctaatatgaagaagctaagaat
ttaatatctgaatctatcaacaaattagatagttaagtcagtggtttattgttggaaagt
tatagcagagcttacgaaagtatcctaagactccagcaactcttcgaaatgcaagaaatc
attgatattaaagaatttgaagagaaagtaaatagtactgcaaatcgtgaagggctgatt
aaaggtatttaagatgcagaaattgaacaaaagagaaagcaattaagagatatatgggct
gatagattatatggtaatcctaaggatattgatacttggtagaaaattttatctgttaga
tagctatacctatctaaaaaagatgatttaaatacatggctaaaattctgcagacttgca
ctcaaaaacaactaaatgcatatatgtaagaagactttagaagaattatacttggagtat
aataaagactcttaactaatgccagcataacttcaattagctgatttagaatgtaattat
caaatgagtattactaaggaaaaagagatttgcgaaaaaatggaagaaattctttaatct
gaaaataagatagataacaaattgactgccaaaatgtacttaaagatgggtaattggata
agagataagactgatgagcttaactcgtttaacatgaaaaaaatcggagaattttactaa
aaagcaaaagattttaagcctgattattacaaaacatggcatcattttggtcttctcaat
tttgatgctattaacatgaaataagatgacacaattattgagtaaaagagagtttatatt
aagaatgctttagaaggatttatgagaagtattactctaggaacttcctcagagcataaa
tctccttatattctttaagactctttgagactgctttctattatatttgagtatggagat
ttggaggatattcacaacaaatttttagaggactttaaataaattgataatcgtgcatgg
attgaagtcgtcccttaaattattgctcgtctttctactacaaaaaagagtgtttaacat
ttattgcactctcttttaactcacatcgcttagtagcatccttaagctcttatatatcct
ctaacagtagctttgaagtcaaaaattcaaattagacaataagccgcaagcaaaattatt
gaaaatatcaaaactcattcacctttgctcataaactaagcactcttaatttcataagaa
ttaaaccgtacagctattttgataaaagaacaatggcttgaaggaatcaaagaagcttgg
gagagatacacaattgataagggtgcacatactcatctaataaaaattttgtagggactt
cacgagatgatgaaagttcctccagaatcattgagtgaaatttccttccactaaaacttt
ggaggtgaaatcttcgaagccgaatcatggttggaaagatataaaataacagaggatgct
atttgtctgtgctaagcatttgatatttattaccgcatttactcaaagcttgatgtttaa
ttaaaaaagctagaatttgtttatttagaaaatgtatcacctaagctattagaaacaaag
aattgtgaagtctctattccaggcttgtacaaaccaactagaccaattgtaaaaatatca
tgcttttagccaaaattggaagtattattctccaaaatgaatcccagaaaattatttgtg
tatggatccgattctaaagaataccacttcttattaaaaggtcgtgaagatatacgttaa
gatgaaagagttatgcagcttttcgctttgataaatcgtttacttcacaacaatcccgaa
acagaaaagaaagacttaaacatttaaagatattcaattattcctctttctattaacaca
ggtttacttggttgggttcataattgcgatactctttaggtccttatcagagaatacaga
aaggcatatcatattagagaaaatcctgaatacaacttgatggagtaaaaatgttctaat
tacagtgttttgcctcttcctaacaaagttgaaattttcagatacattatggaaaacacg
aaaggagaggagcttaaaaaaatcttatggttaaaaagtccaaattcagaaatttggtta
gaaagaagaaccaactacacaagatctcttgctacaatgtctatagctggttatattcta
ggtttaggagatcgccatccttcaaatattatgctttagagatatacaggaaaaattgtg
cacattgactttggtgactgctttgaagtagctatgagaagagaaaaattcccagaaaag
gttccatttagattaactagaatgctcgtcaatgctatggaagcctgttaaatagaagga
aactatagaaatacttgtgagctagtattaaaggtaattagagaaaacaaagaaagtcta
attgcagttttggaagcttttgtctatgatccactattttactggagattaataacaata
tctggtgaagaataaggtgataaagccaatgagaaaaaagaaaaaggagatgcagtatac
caggctaacaaaaagagagagtccagaccttaaagtttgcttgaagtaagcatggtaaac
taggtgagctatgttggtagtattatataacaaggaacaagctaggcgatataaaaatat
atcaagaaagcataaaaaagcaaaataaataattaaaatgatattgatagagcatagtct
cctaaaaatagagaaaaagatatttaagaaaaatattacaatgaagaaaaagaataacca
taagaaaatctaaataaaaaagccgttgaagttatggatcgtattaagaaaaagcttaat
ggtaaagatttctaagaaaatgaatcactaacatacactgaataagttagtaagctaatt
aatcaagctacatctcatgaaaatatttgctaggcttatattgggtggtgtccattttgg
tga

DBGET integrated database retrieval system