KEGG   Tetrahymena thermophila: TTHERM_00148700Help
Entry
TTHERM_00148700   CDS       T01020                                 

Definition
Cytochrome c family protein
Orthology
K08738  
cytochrome c
Organism
tet  Tetrahymena thermophila
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:tet00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 245 aa AA seqDB search
MNRPKGPQPEGTISPEEAEKKWGDKFYTYTGVPKKDMQKEINELEESLESEKIKGLKKFE
ERFELKKIQIAKSKEHIYKGDEKDKKIPVDGDFVEGSRVFMQHCSSCHSLETNNQGRKTT
GPALGLIYGRRAGADPYYNYSPSLVKSSYVWTTRNLFYFLQNPRTLISGNKCEIFGGGIK
SEEERADLIEFLKVYSKQLSENLRHKANKVYGKDYVNYHLQTQLLVEQEEMRRIGIDAAN
DAKKI
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaccaaaaggaccctaaccagaaggaacaatttctccagaagaagctgaaaaa
aaatggggtgataaattttatacatatacaggcgtaccaaaaaaagatatgcaaaaggaa
ataaatgaacttgaagaaagtttagaaagtgaaaagatcaaaggtttaaagaaattcgaa
gaaagatttgagcttaaaaaaatacaaattgctaaatcaaaggaacatatatataaggga
gacgaaaaggataagaaaattcctgttgatggagactttgttgaaggttctagagttttt
atgcaacattgctcaagttgtcattcattagaaacaaataactaaggtagaaaaactact
ggtcctgctttaggtttaatttatggacgcagagctggtgcagatccatattataactat
agcccaagcttagttaaaagttcttacgtatggacaacacgcaatttattctatttcttg
caaaatcctcgtactttaattagtggtaataaatgtgaaatatttggaggtggtattaaa
agtgaagaagagagagctgatcttatagaatttttaaaagtttattcaaaatagctttct
gaaaatttgcgtcataaagctaataaagtttatggaaaagattatgttaattatcactta
caaacctaattacttgttgaataagaggaaatgcgtcgtatcggtattgacgctgcaaat
gatgcaaaaaaaatatga

DBGET integrated database retrieval system