KEGG   Tetrahymena thermophila: TTHERM_00157800Help
Entry
TTHERM_00157800   CDS       T01020                                 

Definition
protoporphyrinogen oxidase family protein (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
tet  Tetrahymena thermophila
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TTHERM_00157800
Enzymes [BR:tet01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     TTHERM_00157800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
AA seq 742 aa AA seqDB search
MSQIVPKIAILGGGVSGLSQSYYLHKMLKKCDIKIFEASNRVSGALQTKNDGGFFFEQGP
RSIRNGNTIFEVLKICEDIGALDLIVPSDNFDNAYVYYDGQLRQLPRKMAAGPLFNFIKD
NPKLVSSAFRINRAKSSSYKGDCNMEQFVQNKLRFAGFQFTGLSDFINTHFVNSFAKGVY
RAESSDLSSELCLKKIHIKDYIHDYIDPTEFKHPKYSDNLQQFIQSGSINFQGGIQTFLF
EVAKHLENKTSTQIELNSPVQQLIFKDKKILVQSGSNNKVEEFDYVISTLNAPQIKQILD
NSQGNQQRVNQTLKKLLCQIEDYYFKQKQINIKINQLKTDLSSIKFLPMVSINLGYNKPV
IPKDLYSFGYLIPSISDKSLIGVVFDSCSYPTLGPKDTTRISLMFGNKIDINSPSEVFIK
EGLKELGEQTGITEKPDKINFYKWEPSFPEYNVNHYYKSLRMLETAKHIHQNFQLHGRYL
FTAAIPELVLLSKCFATQINSRSNQQFFRKDMKEVEFQNKLNRHKTRQSIISECLEYFKS
LSQTRFEGLETQIQQEIKQTLDEYDRRSLIRYQAERNVKEQILCVRDYLKRTGIIEQSKR
EIQNQQMQYVSPILNMKKLDLATEISQKRQSISNDIKQLKMQRDEAKSNIARLRQESTLS
AKNPVLIITQIYKNIFQQNKIVQKKLYDIKTEENISLNFSKESLTNNRQQMGSLVSQSRF
QNFSSNFSNNYSKILSNKNLYN
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgagttaaatagttccaaaaatagcaattttaggaggcggtgtttcaggcttgtcacag
tcttattacttgcataaaatgttgaaaaagtgtgacattaaaatttttgaggcttcaaat
cgagtaagtggagctctctaaacaaaaaacgatggaggattctttttcgaacaaggtcct
cgctcaataagaaatggaaatactatttttgaggtacttaaaatatgcgaagacatagga
gccttagatctcattgtccctagtgataattttgataatgcatatgtttattatgatggt
caactgagataactaccaagaaagatggccgcaggacctttatttaattttattaaagat
aatcccaaactagtttcttcagcattcagaataaatcgtgcaaaatcatcaagttacaag
ggtgattgcaacatggaacaatttgtataaaataaactaagatttgctggtttttaattt
actggattatcagattttataaatacacatttcgttaattcattcgcaaaaggtgtttac
agagcagaatcttctgatctttcttcagaattgtgtcttaaaaagatacatataaaggat
tatatacatgattatatagacccaactgagttcaagcatccaaaatactctgataatttg
taatagtttatctagagtggatctattaatttttaaggagggatttaaacttttcttttc
gaagttgcaaagcatttagaaaataagacatctacataaatagaactaaattcaccagtt
tagtaattgatatttaaggacaaaaagattcttgtttaaagtggaagcaataataaagtt
gaagaatttgattatgtgatttctacattgaatgcacctcaaataaaatagatccttgac
aactcacaaggcaaccaataaagagtaaattaaacattaaaaaaattactttgttaaatt
gaagattattattttaaataaaaataaataaatataaagataaatcaattaaagactgat
ttaagttcaatcaaatttttgcctatggtttctattaatttaggctataacaagccagtc
atccctaaagatttatactcctttggttatctgattccttcaatttcagataaaagttta
attggagttgtatttgatagctgctcttatcctactttaggacccaaagatacaactaga
atttcactaatgtttggcaacaagattgatattaactctccttcagaagtttttataaaa
gaaggtttaaaggagttgggagaataaactggaattacagaaaaaccagataaaattaac
ttctacaagtgggagccaagttttcctgaatataatgtaaatcattattacaaatctcta
agaatgttagaaactgctaagcatatccattaaaatttctagttacacggaagatactta
tttactgctgctattcctgaattagttttgctttcaaagtgttttgcaactcaaataaat
tctcgatctaattaataatttttcagaaaggatatgaaagaagtagaattttaaaataaa
ttgaacagacataaaacgagacaaagcataatatctgaatgcttggaatattttaaaagt
ttatcttaaactagattcgaaggtttagagacttagatttaataagaaattaagtagaca
ttagatgaatacgatagaaggagtcttataagatatcaagctgagagaaacgttaaagaa
caaatattatgtgtaagagattacttaaaaagaacaggaattatagaacaaagtaaaaga
gaaatataaaattaataaatgtagtatgtttctcctattctgaatatgaaaaagctagat
ttagctactgaaatatcccaaaaaagataatctatttcaaacgatattaaataactaaaa
atgtaaagagatgaagccaaatcaaatatagccagattaagataagagtctacattgtca
gccaaaaatccagtattaattattacataaatatataaaaatatattttaataaaacaaa
atcgtataaaaaaagctttatgatatcaaaacagaagaaaatatctcattaaatttctca
aaagaatcattaactaacaatagataataaatgggttctcttgttagttaaagtagattt
tagaattttagctctaatttttctaataattacagcaaaatattatcaaataagaactta
tataattga

DBGET integrated database retrieval system