KEGG   Tetrahymena thermophila: TTHERM_00170320Help
Entry
TTHERM_00170320   CDS       T01020                                 

Definition
Phosphofructokinase family protein (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tet  Tetrahymena thermophila
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:tet01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tet01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tet00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tet00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tet00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tet00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 543 aa AA seqDB search
MDLQKSLTDNKFFVAGLALGSGLITSLLLKQFNTEEEKVERKGSLKTVKRKEVKKQRTVF
LHQTDNTIPKEILNASNTLMEEVKNLESRTCNILKVPNLIIEVPQDEIPCHLSPLYGENN
YREVFGGGGFLPDTAFVYTGSYVLSDAVIGKNQSLDQSKRYVRAGPRKHNYFNPQQVKAA
IVTCGGLCPGLNVVIREIFMCLYFNYGVRTIYGIKYGYKGFYQYDWQELTVKDVKEIQRL
GGTVLGSSRGGFDKDKIVDNLVKHGITHVYCLGGDGTHRGIQALFNEVRSRKLNISIVGI
PKTIDNDIPIIDKSFGFETSVEEAVKAIQSAHVEAHCAEYGVGLVRLMGRYAGFIAMEAT
NASRDAHVCLVPEFKFNLYGEEGVLEYVYQRLLSKRNCIVVVAEGAGEAVLDAQFANTGE
KDASGNAKLNDIGAFLQKEIVDYGKKKGMEVTLKYINPTYMIRTVPANALDRKMCTQLAQ
NAVHGAMAGFTGFTVGHVNNRLCYIPLDEICKEGSGRRIKAEDRAWQRLLASTGQPSFLK
KEN
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggatttgtaaaagagtttaacagataacaagtttttcgtagccggattagcattaggc
tctggattaattacttcattattgttgaagtaattcaatactgaagaagaaaaagttgaa
agaaagggaagccttaaaacagtcaaaagaaaggaagtcaagaagcaaagaacagttttc
ttgcatcaaactgataacactatccctaaagaaattcttaatgctagcaacactctcatg
gaagaagttaagaatcttgaaagtagaacttgcaatattttaaaggttcctaacttgatc
attgaagtccctcaagatgaaattccatgccatctatctcccctttatggtgaaaacaat
tacagagaagtctttggtggtggtggtttccttccagacactgcattcgtttacactggc
tcatacgtattatctgacgctgttattggtaagaaccagagcttagattaatctaagaga
tacgttcgtgctggtcctagaaagcacaattactttaatccttaataggttaaggctgcc
atcgtaacctgtggtggtttatgccctggtttgaatgttgttattagagaaatattcatg
tgtttatacttcaattacggtgtaagaactatctatggtattaaatacggatataagggt
ttctactaatatgactggtaagaacttactgtcaaggatgttaaggaaatataaagactt
ggtggtactgttttgggtagctctagaggtggttttgataaagataaaattgttgataat
ttagttaagcatggtatcactcatgtttactgcttaggtggtgacggtactcatagaggt
atttaagctctttttaacgaagttagaagcagaaaactcaatattagtatcgtaggtatt
ccaaaaactattgataacgatattccaattatagataaatctttcggttttgaaacttca
gttgaggaagctgttaaggcaatctaatctgctcatgttgaagctcactgtgctgaatat
ggtgttggtcttgtcagacttatgggtagatatgcaggttttattgctatggaggcaact
aatgcttcaagagatgctcatgtttgcttagtacctgaattcaagtttaatctttacggt
gaggaaggtgtgttagaatacgtctatcaaagattattatccaaaagaaattgtattgtt
gtagttgctgaaggtgctggtgaagcagttttagatgcacaatttgctaacactggtgaa
aaggatgcttcaggaaatgccaagttaaatgacattggtgctttcttatagaaggaaatt
gtagattacggtaaaaagaaaggaatggaagtcactcttaaatacattaatcccacatac
atgattagaactgtaccagctaatgctttggacagaaaaatgtgcacataacttgcttaa
aatgcagtccatggtgctatggcaggctttactggattcactgttggtcatgttaataac
cgtttgtgttatattccattagacgaaatctgtaaagaaggatctggaagaagaatcaag
gcagaagatagagcttggtagagacttcttgcatctactggctaaccctcctttttaaag
aaagaaaattga

DBGET integrated database retrieval system