KEGG   Tetrahymena thermophila: TTHERM_00185230Help
Entry
TTHERM_00185230   CDS       T01020                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tet  Tetrahymena thermophila
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TTHERM_00185230
   01230 Biosynthesis of amino acids
    TTHERM_00185230
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTHERM_00185230
   00051 Fructose and mannose metabolism
    TTHERM_00185230
   00562 Inositol phosphate metabolism
    TTHERM_00185230
Enzymes [BR:tet01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TTHERM_00185230
Exosome [BR:tet04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TTHERM_00185230
  Exosomal proteins of bladder cancer cells
   TTHERM_00185230
  Exosomal proteins of melanoma cells
   TTHERM_00185230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 256 aa AA seqDB search
MAIRRLFVGGNWKCNNTLAQTKDLVNNVLNKLHFDPAKVDVVVAPVFLHVPWVAEHIQKP
VQVSVQNTSLTGTGAYTGEISVAHVKDLGLNWAILGHSERRQYYGETNEVVANKVKYAVE
NGLDVIACVGEHLADREANQTNQVVEGQLEAIRGKLNEAQWEKIVIAYEPVWAIGTGKVA
TPAQAQEVHEFIRSYLTQKVSQNVSQKTRILYGGSVTEKNAGELIHQKDIDGFLVGGASL
KPAFADIVAACNIVKH
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggctatcagaagactctttgttggtggtaactggaagtgcaacaacaccttggcctaa
actaaggacttggttaacaacgtcttgaacaaattacacttcgaccctgctaaggttgat
gtcgtcgttgctcccgttttcttacacgttccttgggttgctgaacacatccaaaaaccc
gtctaagtctccgtctaaaacacttccctcactggtactggtgcctacactggtgaaatc
agcgttgctcacgttaaggatttaggtttaaattgggctattttgggtcactctgaaaga
agacaatactacggtgaaactaacgaagttgttgccaacaaggttaaatacgctgttgaa
aacggcttagacgttattgcttgcgttggtgaacacttagctgacagagaagccaaccaa
accaaccaagtcgttgaaggttaattagaagctattagaggtaagttgaatgaagctcaa
tgggaaaagatcgtcattgcctacgaacccgtctgggctatcggtactggtaaggttgcc
acccccgcttaagcttaagaagtccacgaattcatcagaagctacttaacccaaaaggtt
tcctaaaacgtttcttaaaagaccagaatcctctacggtggttccgtcactgaaaagaac
gctggtgaattaattcaccaaaaggacatcgatggtttcctcgttggtggtgcttccctc
aagcccgctttcgctgacatcgtcgctgcttgcaacatcgtcaagcattga

DBGET integrated database retrieval system