KEGG   Tetrahymena thermophila: TTHERM_00185230Help
Entry
TTHERM_00185230   CDS       T01020                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tet  Tetrahymena thermophila
Pathway
tet00010  Glycolysis / Gluconeogenesis
tet00051  Fructose and mannose metabolism
tet00562  Inositol phosphate metabolism
tet01100  Metabolic pathways
tet01110  Biosynthesis of secondary metabolites
tet01130  Biosynthesis of antibiotics
tet01200  Carbon metabolism
tet01230  Biosynthesis of amino acids
Module
tet_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tet_M00002  Glycolysis, core module involving three-carbon compounds
tet_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTHERM_00185230
   00051 Fructose and mannose metabolism
    TTHERM_00185230
   00562 Inositol phosphate metabolism
    TTHERM_00185230
Enzymes [BR:tet01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TTHERM_00185230
Exosome [BR:tet04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TTHERM_00185230
  Exosomal proteins of bladder cancer cells
   TTHERM_00185230
  Exosomal proteins of melanoma cells
   TTHERM_00185230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM FlpD FAE1_CUT1_RppA
Motif
Other DBs
NCBI-GeneID: 7827329
NCBI-ProteinID: XP_001008794
TGD: TTHERM_00185230
UniProt: Q22T89
AA seq 256 aa AA seqDB search
MAIRRLFVGGNWKCNNTLAQTKDLVNNVLNKLHFDPAKVDVVVAPVFLHVPWVAEHIQKP
VQVSVQNTSLTGTGAYTGEISVAHVKDLGLNWAILGHSERRQYYGETNEVVANKVKYAVE
NGLDVIACVGEHLADREANQTNQVVEGQLEAIRGKLNEAQWEKIVIAYEPVWAIGTGKVA
TPAQAQEVHEFIRSYLTQKVSQNVSQKTRILYGGSVTEKNAGELIHQKDIDGFLVGGASL
KPAFADIVAACNIVKH
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggctatcagaagactctttgttggtggtaactggaagtgcaacaacaccttggcctaa
actaaggacttggttaacaacgtcttgaacaaattacacttcgaccctgctaaggttgat
gtcgtcgttgctcccgttttcttacacgttccttgggttgctgaacacatccaaaaaccc
gtctaagtctccgtctaaaacacttccctcactggtactggtgcctacactggtgaaatc
agcgttgctcacgttaaggatttaggtttaaattgggctattttgggtcactctgaaaga
agacaatactacggtgaaactaacgaagttgttgccaacaaggttaaatacgctgttgaa
aacggcttagacgttattgcttgcgttggtgaacacttagctgacagagaagccaaccaa
accaaccaagtcgttgaaggttaattagaagctattagaggtaagttgaatgaagctcaa
tgggaaaagatcgtcattgcctacgaacccgtctgggctatcggtactggtaaggttgcc
acccccgcttaagcttaagaagtccacgaattcatcagaagctacttaacccaaaaggtt
tcctaaaacgtttcttaaaagaccagaatcctctacggtggttccgtcactgaaaagaac
gctggtgaattaattcaccaaaaggacatcgatggtttcctcgttggtggtgcttccctc
aagcccgctttcgctgacatcgtcgctgcttgcaacatcgtcaagcattga

DBGET integrated database retrieval system