KEGG   Tetrahymena thermophila: TTHERM_00191450Help
Entry
TTHERM_00191450   CDS       T01020                                 

Definition
Glycosyl hydrolase family 20, catalytic domain containing protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
tet  Tetrahymena thermophila
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TTHERM_00191450
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    TTHERM_00191450
   00603 Glycosphingolipid biosynthesis - globo series
    TTHERM_00191450
   00604 Glycosphingolipid biosynthesis - ganglio series
    TTHERM_00191450
   00511 Other glycan degradation
    TTHERM_00191450
Enzymes [BR:tet01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TTHERM_00191450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 555 aa AA seqDB search
MNLNFKKYLVICLAIAFVASQVTPGVDPIAAKVIPKPKTYTFGTQTLKISNPCNIVYRPQ
VNQAGYVPDHVFQMINLYSNLTFQSTFNSTNCNFVSSNIKQMLNAFDPSNIIFDIFISDM
NLTIADTIQDESYSLNLLNSSYWQLNATKYVGFVRGLETFSQLFVQDEVSSAWSIPSLPI
SIQDSPDYPYRGLMIDTARHFLSVNTILKTIDSMQYNKLNVLHWHITDDDSFPYPLQSFP
NVTQYGAFSFRKQYSLTDIQYIVRYALLRGIQVVPEIDSPGHAFSWGKSPQFSNVALQCD
KFNGQLDPSQKETWQLVNGVLTDLENQFYTSKYIHLGGDEVDEGCWDQSSDLKQYMKDNN
IQNYDDLQTFYRQTQKNLYRKINPTKPAIYWSDKDNYKLGLQPDDIVQWWGEMSNFKLIS
NITNRIILSSQDYAYLDVGFGDELGGDYNQMYNWKAMYAFNPQISGIKGKIIGAEVCLWS
ELSDDDVYLTRIWTRTSAFSERLWNLNASNGQKLKYRALASRMVFMKNRLNARGVKATPV
TLEICERDLSLCFSN
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcaatttcaaaaagtatttggttatctgtttagcaatcgcttttgtggcttca
taagttacaccaggagttgatcctattgctgctaaagttattcctaaaccaaaaacttat
acttttggtacttaaacgcttaaaatttccaacccttgcaacattgtttacagacctcaa
gttaattaagctgggtacgtccctgatcatgtgttctagatgataaatctatattcaaat
ttgacattctaatcaactttcaattcaacaaattgcaattttgttagtagcaacattaaa
taaatgttgaacgcttttgacccttctaatatcatttttgatatcttcataagcgatatg
aatttgactattgcagatactatctaagatgaatcttactctcttaatttattaaattca
tcatattggtaattaaatgcaacaaagtatgtaggatttgttagaggccttgaaacattt
tcatagctctttgtttaagatgaagtctcttctgcttggagcatcccaagtctccctatt
tctatttaggattctcccgactacccttacagaggccttatgatagataccgcaagacac
tttttgagcgttaatactatactaaagacaattgattctatgcaatataataaactaaat
gtattgcattggcatattactgatgacgattcttttccatatccactttaatcatttcca
aatgtgactcaatatggtgctttttcttttagaaaatagtactctttaacagatatttaa
tacatagttagatatgctcttcttagaggaatataagttgttccagaaatagattcccca
ggccatgctttttcttggggtaaaagtcctcaattctctaatgtagcattatagtgtgat
aaatttaatggtcaattagatccctctcaaaaagaaacatggtagcttgttaatggagta
cttactgatctagaaaattaattctacacttctaagtatattcatttaggtggtgatgaa
gtagatgaaggatgctgggattaatcaagtgacctaaagtaatatatgaaagataataat
atttaaaattatgatgatctctaaaccttttatagataaactcaaaaaaatctttacagg
aaaataaatcccactaaacctgctatttattggtcagacaaagataattacaaattagga
ctttagcctgacgatattgtttaatggtggggagaaatgagtaattttaagttaatatct
aatataactaacagaataatcctttcatcttaggattatgcttatttagacgttggattt
ggtgatgagttaggaggagattacaattaaatgtataactggaaagcaatgtatgcattt
aatccttaaatatcaggaataaaaggaaagattattggtgcggaagtttgcttgtggtca
gagctaagtgatgatgatgtatatctaacaaggatatggacaagaacaagcgcattttct
gagagactttggaatttgaacgctagtaatggataaaaactaaaatatagagcattagct
agtagaatggttttcatgaaaaacagattaaatgcaagaggagtaaaagcaactccagta
actcttgaaatctgtgaaagagatctttctttatgctttagtaattga

DBGET integrated database retrieval system