KEGG   Tetrahymena thermophila: TTHERM_00193700Help
Entry
TTHERM_00193700   CDS       T01020                                 

Definition
Protein kinase domain containing protein (EC:2.7.11.1)
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
tet  Tetrahymena thermophila
Brite
Enzymes [BR:tet01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     TTHERM_00193700
Protein kinases [BR:tet01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   TTHERM_00193700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 756 aa AA seqDB search
MIGNLDKKRTDKRVVIGGIPKNNIDLRILEKPEKYTVVQKKKTYQDIKFIITCLKNHFVF
YNLQDSQLETLVNEMSYCEVNQGEQVIKQGDDAFCFFLLEKGEIEVQVNQQKVRKLKDGE
GFGELALLYNAPRSATCVALSKSYFWMIERNTFRKAVEEMITQEYQQNRKFIEKITFFQN
LTSNQKDAIAGVLIDQRFLKEQNIVNKDDPASSFYIIKEGKVSVMLGDKEVRTLGQGESF
GETALLQGDQTRTMTIKALEDTTCLALGRDVLTKLLGDKVEMIIYRNISKWALEKSDGFK
ELTINQLDKILDSIQISHITKGRVIIPKGTQKAQQLYIILKGSVKDGDIVYQKSQLLGAK
EIINADETSVYEQNIVTEEDSVIGQVKISDLVAKLSGTLQDILKKNQKVSEQLEAKESQI
RQNIENLTIDDLEVVKKLGNGQFGSVYLVKNKDTKQIYALKCVSKSSVVETSLEKHLIQE
KKVMQTVNYPFIMRFFRSFKDDYYIYFLLEFIQGQELFEVIREIGLLSTWDSQFYIGSII
LALEYLHSRKIIYRDIKPENIMITHKGYLKLIDMGTAKIMQTNAGTMTRTFTIIGTPHYM
APEVISGKGYSYLVDLWSVGICLYEFMCGYVPFGEEAEDPYEIYEEIIKKEINFPNYLSD
PMAKSLMEQLLSRVPEMRTGGSYSSLKSHQFFRNVDWIKLSDMNYQPPYQPSNQSYLTTE
QVLKAPGKQIQQQIKEEFGALKLPNASKVVDWDKIF
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgataggaaatttagacaaaaaaagaactgataagagagtagtgattggtggcattcca
aaaaataatatagatttaaggatacttgagaagccagaaaagtatactgtagtatagaag
aaaaagacatattaagacattaaatttattattacatgcttaaaaaaccacttcgtattt
tacaacttacaagactcgtagctggagactttagtaaatgagatgagctattgtgaagtt
aaccaaggagagtaagtaatcaagtaaggagatgatgcattttgctttttccttttggaa
aagggagagatagaagttcaggttaattaatagaaagttagaaaattaaaagatggtgaa
gggtttggcgaattggcccttctatacaatgcccctcgttcagctacttgtgttgcttta
tccaaatcttacttctggatgattgaaagaaacacatttaggaaggctgttgaagaaatg
attacgtaggaataccaataaaataggaaatttatagaaaagataacttttttctaaaat
ttgacttcaaattagaaagacgcaatagcaggagtattaattgaccagcgctttttgaaa
gaatagaatattgttaacaaagatgatccagcaagttcattttacattattaaagaaggt
aaagtgagtgtaatgctcggtgataaagaagtaagaactttgggttaaggtgaatctttt
ggcgaaactgcactattacaaggagattaaactagaactatgactattaaagcattagaa
gacactacatgccttgccctaggaagagacgtacttacaaagttactcggagacaaagtt
gaaatgatcatatatagaaacatatctaagtgggccttagaaaaatctgatggtttcaaa
gagctaactattaactaactagataaaatattagacagcatataaatttctcatattact
aaaggtagagttattattcctaaaggtacttaaaaggcacaacagttatacatcattctt
aaaggatctgttaaggatggagatattgtttactagaaaagttaattgcttggagcaaag
gaaattattaatgccgacgagacttctgtgtatgagtaaaatattgtcacagaagaagat
tcagttattggttaagtgaaaatttctgaccttgttgcaaagttaagtggaactttatag
gatattttgaagaaaaattaaaaagttagcgaatagcttgaagccaaagaatcttaaatc
agacaaaatatagaaaatcttacaatagacgatcttgaagtagtaaaaaaattaggaaat
ggataatttggatctgtttatttggtcaaaaataaagacacaaaacaaatctatgcactt
aaatgtgtttctaaatcaagcgttgttgagaccagcctagaaaagcatttaattcaagaa
aagaaagtcatgcaaacagttaactatcctttcatcatgagatttttccgctcatttaag
gatgactactatatttacttcttactagaattcatttaaggttaagagctttttgaagtt
atcagagaaataggtttacttagtacttgggattcacaattttacattggttctattatt
ctagcactcgaatatcttcattctcgaaagataatttatagagatattaaaccagaaaac
atcatgattactcacaagggatatcttaagttaatagacatgggtactgcaaagatcatg
taaactaatgctggcacaatgacacgtacatttactattatcggaactcctcattatatg
gcacctgaagttatttctggtaaaggttatagctatttagttgatctttggtcagtaggt
atttgcctctacgaatttatgtgtggatatgttccttttggtgaagaagctgaagaccct
tatgaaatctatgaggaaattataaaaaaggagattaatttccccaattatttaagtgat
cctatggctaaatctttaatggaatagcttttatccagagttcctgaaatgagaacagga
ggttcttacagttctttgaaaagccattaattcttcagaaatgttgattggattaaatta
tctgatatgaattattaaccaccttatcagccttcaaattagagctatttaactacagaa
taagttttaaaggcgcctggaaagtaaattcaataataaatcaaagaagaatttggagct
cttaaattaccaaatgcatctaaagtagtcgattgggacaagatcttttga

DBGET integrated database retrieval system