KEGG   Tetrahymena thermophila: TTHERM_00198200Help
Entry
TTHERM_00198200   CDS       T01020                                 

Definition
Cytochrome P450 family protein (EC:1.14.14.1)
Organism
tet  Tetrahymena thermophila
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
AA seq 496 aa AA seqDB search
MKQKHGDKIKTFFHIGEGIFKEYYTNLTQKKDSVAFIRGIHQKNIKALAYNLGTRICLNF
VDPELVKQVHQNPEAFRKNDASLAITFLFGNSILFAKGKSWQRQRQFLGKSFHFEEIKNY
LPLIKEICDKVFERVSEKLTQNDQLEINAVKICEQVTSEVVFRAFFGSTTQNLVITRQDG
SQIPIADELIQAIMNSFQLLKKDKIALFKYLIFGRNSTKFLRTQGEQSILNRLIAIKESC
LQVVQQRKNQLQNDPTQAKKNFLDQYLYDMITNKQSEVNNEEIIDNFLGLFFAGTDTTGN
MTGVALYYLSRYPDIQKQAREEVIQILSQNSNKRNHSELFSQLTFENLQNMNLINSILKE
SLRLIPPAIEVFPRVAIHNMKIGEFQIKKGDLVSTYFIYNQSNPELYQDPEIFNPQRWMN
VKDSQNNFNFTPFSLGPRNCIGQHLAMIEGKCMLACILLNFDILPNYQQEVVKELRVIYG
FQKDNLIYFKQRKQNN
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaataaaagcatggagataaaatcaaaacatttttccatattggtgaaggtattttt
aaagaatattatacaaatttaacttagaagaaagatagcgtagcatttataaggggcata
cactaaaaaaacattaaagctcttgcttataatcttggtactagaatatgcttaaacttt
gtagatcctgagcttgtcaaacaagtacactaaaatccagaagcttttcgcaaaaatgat
gcatctttagcaataacatttttatttggtaattcaatcctattcgcaaaaggaaaaagt
tggcaaagacaaagataatttttaggcaagtcttttcatttcgaagagattaaaaactat
ctaccactaattaaagaaatttgtgataaagtttttgaaagagtaagcgaaaaactaact
caaaacgatcaattagagataaatgctgtcaaaatatgcgaataagtcacttctgaagtt
gtttttagggcattttttgggtcaactacttaaaatttagtcattacaagataagatgga
agccaaataccaattgctgatgaactcatataagcaatcatgaactcattttaactctta
aaaaaagataaaatagctctttttaaatatttaattttcggaagaaatagcactaagttc
ctccgcacctaaggagagcaaagcatattaaatcgcttgattgctattaaagaaagctgt
ctctaagtggtttaataaagaaagaattaactatagaatgatcctacttaagcaaaaaaa
aactttttagattaatatttgtatgatatgataacaaataaatagagtgaagtaaataat
gaagaaattattgataatttcttaggacttttttttgcaggaacagacactactggaaat
atgactggagttgctttgtactatctgtccaggtatcctgatatttagaaataagctaga
gaagaagtcatttaaatcctctcttaaaactctaataaaagaaatcatagtgaactattt
agccagttaacatttgaaaatctataaaacatgaatttgataaacagtattttaaaggaa
tcgttaaggttaatccctcctgctatagaagtttttcctagagtagcaattcataacatg
aaaattggcgaattctagattaaaaaaggagatttagtatctacctatttcatttataat
taatctaacccagaactttatcaggatccagaaatatttaatcctcaaaggtggatgaat
gtaaaagactcatagaataatttcaactttactccgttttcactaggccctagaaattgc
atcggttagcatcttgctatgattgaaggaaaatgcatgcttgcttgcatattactaaac
ttcgatattttacctaactattaataggaagttgtgaaggaattgagagttatttatgga
ttccaaaaagataatctcatatattttaaataaaggaaataaaataattga

DBGET integrated database retrieval system