KEGG   Tetrahymena thermophila: TTHERM_00198200Help
Entry
TTHERM_00198200   CDS       T01020                                 

Definition
(RefSeq) cytochrome P450 family monooxygenase
Organism
tet  Tetrahymena thermophila
SSDB OrthologParalogGFIT
Motif
Pfam: p450 IL3 DUF4116
Motif
Other DBs
NCBI-GeneID: 7823503
NCBI-ProteinID: XP_001007001
TGD: TTHERM_00198200
UniProt: Q22NM9
AA seq 529 aa AA seqDB search
MILVSYIALGAIVLLIAIFIYNLILYPQIRLNLMKQKHGDKIKTFFHIGEGIFKEYYTNL
TQKKDSVAFIRGIHQKNIKALAYNLGTRICLNFVDPELVKQVHQNPEAFRKNDASLAITF
LFGNSILFAKGKSWQRQRQFLGKSFHFEEIKNYLPLIKEICDKVFERVSEKLTQNDQLEI
NAVKICEQVTSEVVFRAFFGSTTQNLVITRQDGSQIPIADELIQAIMNSFQLLKKDKIAL
FKYLIFGRNSTKFLRTQGEQSILNRLIAIKESCLQVVQQRKNQLQNDPTQAKKNFLDQYL
YDMITNKQSEVNNEEIIDNFLGLFFAGTDTTGNMTGVALYYLSRYPDIQKQAREEVIQIL
SQNSNKRNHSELFSQLTFENLQNMNLINSILKESLRLIPPAIEVFPRVAIHNMKIGEFQI
KKGDLVSTYFIYNQSNPELYQDPEIFNPQRWMNVKDSQNNFNFTPFSLGPRNCIGQHLAM
IEGKCMLACILLNFDILPNYQQEVVKELRVIYGFQKDNLIYFKQRKQNN
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgattttagttagttatattgctttaggtgcgattgttctacttattgctatttttata
tacaatcttatcctatatccctaaataagattgaatctaatgaaataaaagcatggagat
aaaatcaaaacatttttccatattggtgaaggtatttttaaagaatattatacaaattta
acttagaagaaagatagcgtagcatttataaggggcatacactaaaaaaacattaaagct
cttgcttataatcttggtactagaatatgcttaaactttgtagatcctgagcttgtcaaa
caagtacactaaaatccagaagcttttcgcaaaaatgatgcatctttagcaataacattt
ttatttggtaattcaatcctattcgcaaaaggaaaaagttggcaaagacaaagataattt
ttaggcaagtcttttcatttcgaagagattaaaaactatctaccactaattaaagaaatt
tgtgataaagtttttgaaagagtaagcgaaaaactaactcaaaacgatcaattagagata
aatgctgtcaaaatatgcgaataagtcacttctgaagttgtttttagggcattttttggg
tcaactacttaaaatttagtcattacaagataagatggaagccaaataccaattgctgat
gaactcatataagcaatcatgaactcattttaactcttaaaaaaagataaaatagctctt
tttaaatatttaattttcggaagaaatagcactaagttcctccgcacctaaggagagcaa
agcatattaaatcgcttgattgctattaaagaaagctgtctctaagtggtttaataaaga
aagaattaactatagaatgatcctacttaagcaaaaaaaaactttttagattaatatttg
tatgatatgataacaaataaatagagtgaagtaaataatgaagaaattattgataatttc
ttaggacttttttttgcaggaacagacactactggaaatatgactggagttgctttgtac
tatctgtccaggtatcctgatatttagaaataagctagagaagaagtcatttaaatcctc
tcttaaaactctaataaaagaaatcatagtgaactatttagccagttaacatttgaaaat
ctataaaacatgaatttgataaacagtattttaaaggaatcgttaaggttaatccctcct
gctatagaagtttttcctagagtagcaattcataacatgaaaattggcgaattctagatt
aaaaaaggagatttagtatctacctatttcatttataattaatctaacccagaactttat
caggatccagaaatatttaatcctcaaaggtggatgaatgtaaaagactcatagaataat
ttcaactttactccgttttcactaggccctagaaattgcatcggttagcatcttgctatg
attgaaggaaaatgcatgcttgcttgcatattactaaacttcgatattttacctaactat
taataggaagttgtgaaggaattgagagttatttatggattccaaaaagataatctcata
tattttaaataaaggaaataaaataattga

DBGET integrated database retrieval system