KEGG   Tetrahymena thermophila: TTHERM_00224620Help
Entry
TTHERM_00224620   CDS       T01020                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tet  Tetrahymena thermophila
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    TTHERM_00224620
Enzymes [BR:tet01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     TTHERM_00224620
Exosome [BR:tet04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TTHERM_00224620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
AA seq 529 aa AA seqDB search
MFSTLLSLISKQTGKIENKANSAEILIGTIDQSTTATKFVVFDTHGQLIDKEIIPHDQIT
LHPGWLEHNPEQILVNTHQAINNTIKRIEEKGYKRENIKTIGITNQRETVVAWNKNTGKS
YHNAIVWSDTRTHEICKRWLAKHDNNSNIYSKITGLPINTYFSAFKIRWLIENVPEIQKE
LDENVIFGTMDSWVIWNLTNKLHLTDVTNASRTFLLNINTLQYEEKILNEFGIPSKCLPK
VLSSAENYGVIENGLLKGISIGACMGDQQAASLGHGLFQVGDSKNTYGTGCFLLVNIGNT
PVYKEGGLLTTVLYKLGQDKPTYYAFEGSIEVGGSSINWARDNLAIKNQLSNIIPPPPPP
KLVESIDDSGDLCFVPAFSGLFSPYWREDAAGCILGLSLHTKREHILRALLEGIAYRTKD
VIETVESSTGNKIESLKVDGGLTNSAFLMRFQADILQRKVLQTRVAESTCLGVAFAAGLT
AQIYKDIEDIKKCIQIDRQIEPHIEFQEKSKQLYKKWQLAVEKSLKWKD
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgttttcaactttattaagtttaataagcaagcaaacaggcaaaatcgaaaataaggca
aattctgctgagattttgataggaacaatagactagagcacaacagcaacaaaatttgtt
gtttttgatactcatggttaattgatcgacaaggaaattattcctcatgatcaaataact
cttcatccaggctggctcgaacacaatccagaataaatcttagtgaatacccatcaagct
attaataataccatcaaaagaatagaagaaaaaggttacaaaagagaaaacatcaagaca
attggaattacaaatcagagagagactgtagtggcatggaacaaaaacacaggtaaatct
tatcataacgctattgtatggagcgatactagaactcatgaaatttgcaagagatggctt
gctaaacacgacaacaatagcaatatatattcaaaaataactggattgccaattaataca
tatttttcagcattcaaaataagatggttgattgaaaatgttcctgaaatctaaaaagag
ttagatgaaaatgtcatctttggaacaatggactcttgggttatatggaatttgacaaac
aaattgcatttgactgatgtaacaaatgcctccagaacatttttgctcaacatcaacact
ttgtagtatgaagaaaaaatattgaatgaatttggtattcctagcaaatgtttaccaaaa
gttttgtccagtgctgaaaattatggtgtcattgaaaatggattgcttaaaggtattagc
atcggagcttgtatgggagattagcaagctgctagtttaggtcatggattattttaagta
ggagactctaaaaatacctatggtacaggctgtttcttattagtaaacattggcaacact
cctgtttacaaagaaggaggcttgttaactacagttctctataagttaggttaagataag
cctacctattatgcttttgaaggatctatcgaagtaggaggatcttcaattaactgggct
agagacaatctagctatcaaaaactagctttctaatatcatcccccccccccccccccct
aaattagtggaaagcattgatgatagtggcgatctatgttttgtaccagcttttagtggc
ttgttttcaccttactggagggaagatgcagcaggttgcatacttggtttatctttacat
actaaaagagaacatattttaagagctttattagaaggcattgcttacagaactaaagat
gtaattgaaactgttgaatcatctacaggaaataaaatagaaagcttgaaagttgatggt
ggtttgactaatagtgcttttttgatgagattttaggctgatatattacaaagaaaagta
ttgtaaacaagagttgctgaaagtacctgccttggagttgcttttgctgcaggtttgact
gcatagatctataaagatatcgaagacataaagaaatgcatttaaattgatagataaata
gaaccccatattgagttttaagagaaatcgaaacagctttataaaaagtggcaattagct
gttgaaaaatctttaaaatggaaagattga

DBGET integrated database retrieval system