KEGG   Tetrahymena thermophila: TTHERM_00224620Help
Entry
TTHERM_00224620   CDS       T01020                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tet  Tetrahymena thermophila
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tet00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 529 aa AA seqDB search
MFSTLLSLISKQTGKIENKANSAEILIGTIDQSTTATKFVVFDTHGQLIDKEIIPHDQIT
LHPGWLEHNPEQILVNTHQAINNTIKRIEEKGYKRENIKTIGITNQRETVVAWNKNTGKS
YHNAIVWSDTRTHEICKRWLAKHDNNSNIYSKITGLPINTYFSAFKIRWLIENVPEIQKE
LDENVIFGTMDSWVIWNLTNKLHLTDVTNASRTFLLNINTLQYEEKILNEFGIPSKCLPK
VLSSAENYGVIENGLLKGISIGACMGDQQAASLGHGLFQVGDSKNTYGTGCFLLVNIGNT
PVYKEGGLLTTVLYKLGQDKPTYYAFEGSIEVGGSSINWARDNLAIKNQLSNIIPPPPPP
KLVESIDDSGDLCFVPAFSGLFSPYWREDAAGCILGLSLHTKREHILRALLEGIAYRTKD
VIETVESSTGNKIESLKVDGGLTNSAFLMRFQADILQRKVLQTRVAESTCLGVAFAAGLT
AQIYKDIEDIKKCIQIDRQIEPHIEFQEKSKQLYKKWQLAVEKSLKWKD
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgttttcaactttattaagtttaataagcaagcaaacaggcaaaatcgaaaataaggca
aattctgctgagattttgataggaacaatagactagagcacaacagcaacaaaatttgtt
gtttttgatactcatggttaattgatcgacaaggaaattattcctcatgatcaaataact
cttcatccaggctggctcgaacacaatccagaataaatcttagtgaatacccatcaagct
attaataataccatcaaaagaatagaagaaaaaggttacaaaagagaaaacatcaagaca
attggaattacaaatcagagagagactgtagtggcatggaacaaaaacacaggtaaatct
tatcataacgctattgtatggagcgatactagaactcatgaaatttgcaagagatggctt
gctaaacacgacaacaatagcaatatatattcaaaaataactggattgccaattaataca
tatttttcagcattcaaaataagatggttgattgaaaatgttcctgaaatctaaaaagag
ttagatgaaaatgtcatctttggaacaatggactcttgggttatatggaatttgacaaac
aaattgcatttgactgatgtaacaaatgcctccagaacatttttgctcaacatcaacact
ttgtagtatgaagaaaaaatattgaatgaatttggtattcctagcaaatgtttaccaaaa
gttttgtccagtgctgaaaattatggtgtcattgaaaatggattgcttaaaggtattagc
atcggagcttgtatgggagattagcaagctgctagtttaggtcatggattattttaagta
ggagactctaaaaatacctatggtacaggctgtttcttattagtaaacattggcaacact
cctgtttacaaagaaggaggcttgttaactacagttctctataagttaggttaagataag
cctacctattatgcttttgaaggatctatcgaagtaggaggatcttcaattaactgggct
agagacaatctagctatcaaaaactagctttctaatatcatcccccccccccccccccct
aaattagtggaaagcattgatgatagtggcgatctatgttttgtaccagcttttagtggc
ttgttttcaccttactggagggaagatgcagcaggttgcatacttggtttatctttacat
actaaaagagaacatattttaagagctttattagaaggcattgcttacagaactaaagat
gtaattgaaactgttgaatcatctacaggaaataaaatagaaagcttgaaagttgatggt
ggtttgactaatagtgcttttttgatgagattttaggctgatatattacaaagaaaagta
ttgtaaacaagagttgctgaaagtacctgccttggagttgcttttgctgcaggtttgact
gcatagatctataaagatatcgaagacataaagaaatgcatttaaattgatagataaata
gaaccccatattgagttttaagagaaatcgaaacagctttataaaaagtggcaattagct
gttgaaaaatctttaaaatggaaagattga

DBGET integrated database retrieval system