KEGG   Tetrahymena thermophila: TTHERM_00224620Help
Entry
TTHERM_00224620   CDS       T01020                                 

Definition
(RefSeq) proteobacterial glycerol kinase-like protein
Organism
tet  Tetrahymena thermophila
SSDB OrthologParalogGFIT
Motif
Pfam: FGGY_N FGGY_C BcrAD_BadFG Nt_Gln_amidase RE_Alw26IDE
Motif
Other DBs
NCBI-GeneID: 7846695
NCBI-ProteinID: XP_001014192
TGD: TTHERM_00224620
UniProt: Q23C21
AA seq 566 aa AA seqDB search
MFRLLSDQQIIYPQQNQNESFVSKQINKQANKLVNKQISLLSKMFSTLLSLISKQTGKIE
NKANSAEILIGTIDQSTTATKFVVFDTHGQLIDKEIIPHDQITLHPGWLEHNPEQILVNT
HQAINNTIKRIEEKGYKRENIKTIGITNQRETVVAWNKNTGKSYHNAIVWSDTRTHEICK
RWLAKHDNNSNIYSKITGLPINTYFSAFKIRWLIENVPEIQKELDENVIFGTMDSWVIWN
LTNKLHLTDVTNASRTFLLNINTLQYEEKILNEFGIPSKCLPKVLSSAENYGVIENGLLK
GISIGACMGDQQAASLGHGLFQVGDSKNTYGTGCFLLVNIGNTPVYKEGGLLTTVLYKLG
QDKPTYYAFEGSIEVGGSSINWARDNLGLFKTYDELQRLVESIDDSGDLCFVPAFSGLFS
PYWREDAAGCILGLSLHTKREHILRALLEGIAYRTKDVIETVESSTGNKIESLKVDGGLT
NSAFLMRFQADILQRKVLQTRVAESTCLGVAFAAGLTAQIYKDIEDIKKCIQIDRQIEPH
IEFQEKSKQLYKKWQLAVEKSLKWKD
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgtttagattgctatctgatcaataaattatttatccttaataaaatcaaaacgaatct
tttgtaagtaagtaaataaataaataagcaaataaattagttaataaataaatatctttg
ttatcaaaaatgttttcaactttattaagtttaataagcaagcaaacaggcaaaatcgaa
aataaggcaaattctgctgagattttgataggaacaatagactagagcacaacagcaaca
aaatttgttgtttttgatactcatggttaattgatcgacaaggaaattattcctcatgat
caaataactcttcatccaggctggctcgaacacaatccagaataaatcttagtgaatacc
catcaagctattaataataccatcaaaagaatagaagaaaaaggttacaaaagagaaaac
atcaagacaattggaattacaaatcagagagagactgtagtggcatggaacaaaaacaca
ggtaaatcttatcataacgctattgtatggagcgatactagaactcatgaaatttgcaag
agatggcttgctaaacacgacaacaatagcaatatatattcaaaaataactggattgcca
attaatacatatttttcagcattcaaaataagatggttgattgaaaatgttcctgaaatc
taaaaagagttagatgaaaatgtcatctttggaacaatggactcttgggttatatggaat
ttgacaaacaaattgcatttgactgatgtaacaaatgcctccagaacatttttgctcaac
atcaacactttgtagtatgaagaaaaaatattgaatgaatttggtattcctagcaaatgt
ttaccaaaagttttgtccagtgctgaaaattatggtgtcattgaaaatggattgcttaaa
ggtattagcatcggagcttgtatgggagattagcaagctgctagtttaggtcatggatta
ttttaagtaggagactctaaaaatacctatggtacaggctgtttcttattagtaaacatt
ggcaacactcctgtttacaaagaaggaggcttgttaactacagttctctataagttaggt
taagataagcctacctattatgcttttgaaggatctatcgaagtaggaggatcttcaatt
aactgggctagagacaatctaggactttttaaaacatatgatgaactgcaaagattagtg
gaaagcattgatgatagtggcgatctatgttttgtaccagcttttagtggcttgttttca
ccttactggagggaagatgcagcaggttgcatacttggtttatctttacatactaaaaga
gaacatattttaagagctttattagaaggcattgcttacagaactaaagatgtaattgaa
actgttgaatcatctacaggaaataaaatagaaagcttgaaagttgatggtggtttgact
aatagtgcttttttgatgagattttaggctgatatattacaaagaaaagtattgtaaaca
agagttgctgaaagtacctgccttggagttgcttttgctgcaggtttgactgcatagatc
tataaagatatcgaagacataaagaaatgcatttaaattgatagataaatagaaccccat
attgagttttaagagaaatcgaaacagctttataaaaagtggcaattagctgttgaaaaa
tctttaaaatggaaagattga

DBGET integrated database retrieval system