KEGG   Tetrahymena thermophila: TTHERM_00237490Help
Entry
TTHERM_00237490   CDS       T01020                                 

Definition
SNF2 family N-terminal domain containing protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
tet  Tetrahymena thermophila
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tet03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 1046 aa AA seqDB search
MLKKPFKPPGSKDGSENTSGLSKPFQKPLLKQTISAPSNLESAKATKKEESVDSKEQPIS
DSENLKENKEKTTPVIQNKPQGLLGLKSKPFKPLVSKLEVKSNTDTKTQMKPSSTFSTNP
TAKNQPPQQEEKNSPEEFYKCFWSKDVKKKHKVLDDGIIVFTSSKVQIYNSDGEKIYDSY
KSKLYCPNPDNGNQYIVGQYFVEQDDKISKDDFLSGRCFVKAKMTYEKDQTMQFSLFLAT
LLIKISYQNQNLTLFCLKYIKSAKKKIAPMKKNTQSEGPKPSDIVVPENSYLLTDPSNKQ
LFPVYIDVYLNNSMRIHQRLGVKFMFECISGLRGPDIGGCILADSMGLGKTLQTIALIWT
LIRRNPHSGTSPLIRKVVVVAPVSLLGSWNKEVKKWLGDARLIPKIALGKRETVIRICKE
FASSSAKMLLISYEQFRMHVETLSNACDLLIFDEGHRLKNMNIKTFRSFNSIKCNRRIIL
TGTPLQNSLDEFYSCVKFVNPNIFENEKQFKFVFSDPILAALKSDASADAVEKAAVRSKE
LTHIISRFVLRRKADILEKLLPPRSEYFIFLKLTPFQNMLYKKMIQARYNKSELDTGEGA
FGLLTIMRKLLNHPQLIYTDVGNQTSQEFKQYFPQDYQLDDWEASFKFKFISDLLDQMRQ
IEIAQKSTERIIIVSYWTQTLDVLQIMIKQKNLKFVRLDGSVNAQKRQELIDRFQDPTND
IKVFLLCGSAGGTGLNLSAANRMVLMEANWNPSNDLQVMGRIWRDGQTKPVHIYRLVACG
TMEEKVLQRQFLKEDLSQNVVDEKMIVKQYNNDKLKQLFEFKGDNQCTSFKEDENQLNQL
KEFTPDYVDTMEKYITFVKRTIKGEKKDQEQESENVIDNAFDEGNIFLKPEAQNEDEADG
EDSLDDKEINEEEEEKIREELTKDISESTAATGELSRIIEEDDKNVKECNESDDDFAIFN
YAKKKDSDNEQPIKEIKNEDLIDNQIAAEKEEESQNKDNKEADMQVEEKAEDEDEVVVTK
GRRGRRKATTTSDTNPAKNILKKLKK
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaaaaccattcaaacctcctggatctaaagatggttcagaaaatacaagcggt
ttatcaaaaccattttaaaagccattgctgaaataaactatttctgctccttctaactta
gagtcagcaaaagctactaagaaagaagagtcagttgactcaaaagaatagcctattagt
gattcagaaaatttaaaagaaaacaaagaaaaaactactcctgtaatttaaaataaacca
tagggcttattaggattgaagtcaaagccattcaaacctttagtaagtaagttagaagtt
aaaagtaatactgatactaaaacttaaatgaaacctagctcaacttttagcacaaatcct
acagcaaaaaattaaccaccataataagaagaaaaaaatagtcctgaagaattttataaa
tgcttttggtcgaaagacgttaagaaaaaacacaaagtattagatgatggtattatagta
tttacttctagtaaagtataaatatataactcagatggagaaaaaatttacgatagctac
aaatcaaaactgtattgtcctaatccagataatggaaactaatacatagtaggttaatat
tttgttgagcaggatgataaaatatcaaaagatgatttcttaagtggaagatgctttgtc
aaggccaaaatgacttatgaaaaagattaaacaatgtaatttagtttatttttagctact
cttttgataaagatttcttactaaaactaaaatttaactcttttttgtctaaaatacatt
aaaagcgccaaaaaaaaaatagccccaatgaagaaaaatacatagtctgaagggcctaaa
ccctcagatatagttgttcctgaaaactcgtatttgctcactgacccttctaataaataa
ctttttcctgtttacatcgatgtttacttgaataatagcatgagaattcatcaaagattg
ggtgttaaatttatgtttgagtgtatttcaggccttagaggacctgatattggtggttgc
attttagctgatagtatgggtctcggtaagacacttcaaacaatagcattaatctggact
ttgataagaagaaatccacattcaggaacttcacctttaattagaaaagttgtagtagta
gcaccagtaagtctattaggaagttggaataaagaagtaaaaaaatggctaggagatgca
cgtttaatccctaaaatagctttaggcaaaagagaaacagtaatcagaatttgcaaagaa
ttcgcaagtagctcagctaaaatgcttctaatttcttacgagtaatttagaatgcatgta
gagactttatctaatgcttgtgacctcttaattttcgatgaaggtcacagactcaaaaac
atgaatatcaaaacatttagatcttttaattcaattaaatgcaataggcgtattatacta
actggtacaccacttcagaactctttagatgaattctactcttgtgttaagtttgttaac
ccgaatatctttgaaaacgaaaagtagtttaaatttgttttttcagatcctattttggca
gctttaaaaagtgatgcttctgcagatgctgtcgaaaaggctgctgtaagaagtaaagaa
ctcactcatataatcagtagattcgttttaagaagaaaggctgatattttggaaaaatta
ttacctcctcgttctgaatactttatctttttgaagcttacacctttttaaaacatgtta
tataagaagatgatataagcaagatataataaaagcgaacttgatactggtgaaggtgct
tttggccttctgactataatgagaaagttactcaatcacccttagcttatatacactgat
gtaggcaaccaaacgtcttaagagtttaagcaatatttcccttaagattatcaacttgat
gattgggaagcttcttttaagtttaaatttatttcagatttactagattaaatgagatag
attgaaatagcctaaaaatcaactgaaagaataattatcgtatcttattggacttaaact
cttgatgttctataaattatgatcaaataaaaaaatttaaaatttgtccgtcttgatggt
tcagtgaatgcacaaaaaagataagaattgattgatagattctaagaccccactaatgac
atcaaagttttcttgctttgtggtagtgcaggtggtacaggtttaaatcttagtgcagca
aacagaatggttttaatggaagctaactggaatccttcaaacgatttataggttatggga
agaatttggagagatggataaacaaaaccagtgcatatttacagattagttgcttgtggc
actatggaagaaaaagttctacagagatagttcttgaaagaagacttaagttaaaatgta
gttgatgaaaaaatgattgttaaacaatataataatgataaactaaaataactttttgaa
tttaagggagataattaatgtaccagctttaaagaagatgaaaattaattaaattaatta
aaagagtttactcctgattatgttgatactatggagaaatatataacttttgtaaagaga
acaattaagggagaaaagaaagattaggagtaagagagtgaaaatgtaattgataatgct
tttgatgaaggaaatattttcttaaaaccagaagcctaaaatgaagatgaagctgatgga
gaagattcattagatgataaagaaattaatgaagaagaggaagaaaaaataagagaagaa
ttaactaaagacatctctgaatccacagcagcaacaggagagctaagcagaataatagag
gaagatgataaaaatgttaaagagtgtaatgagagtgatgatgattttgctatatttaat
tatgctaaaaaaaaggattcagataatgaataacccataaaagaaataaagaatgaagat
cttatagataactaaattgcagctgaaaaggaggaagaatcataaaataaagataataaa
gaagcagatatgcaagttgaagaaaaagctgaagatgaagatgaagttgttgtaacaaaa
ggcagaagaggaagaagaaaagcaactacaacaagtgatactaatccagccaaaaatata
cttaaaaaattaaaaaaatga

DBGET integrated database retrieval system