KEGG   Tetrahymena thermophila: TTHERM_00238830Help
Entry
TTHERM_00238830   CDS       T01020                                 

Definition
Serine/threonine protein phosphatase PP1, putative
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
tet  Tetrahymena thermophila
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:tet03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 321 aa AA seqDB search
MVDKGAKQVDIDVDSIIEKLIACKEYKPGKQASMTEQEIRGLCIKAREIFINQPILLELE
APLKICGDIHGQYYDLLRLFQYGHYPPDTNYLFLGDYVDRGKQSLETIALLLAYKIKYPE
NFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAVIDEKIFCMHGGL
SPELTNLEQIRRIIRPTDVPDTGLLCDLLWSDPDKDVQGWAENERGVSYVFSPEIVSVFL
KKHELDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMTVDETLMCSFQIL
KPADSRTTGQAGRPYTPPKSK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggttgataaaggtgcaaaataagttgacatcgatgtagatagcatcatcgaaaagctt
attgcttgtaaggaatacaagccaggtaaataggcaagtatgacagaataagaaataaga
ggtttgtgcataaaagctagagaaattttcattaattaacccattctccttgagctcgaa
gcaccactaaaaatttgcggtgatattcacggacaatattatgatttgcttcgtctcttc
taatacggccattatcctcccgatactaactatttattcttaggtgattatgttgataga
ggtaaataaagtttagaaacaatagctcttttacttgcatacaaaataaaatatcctgag
aacttcttcttactgagaggtaatcatgaatgcgcatcaattaatagaatctatggtttc
tacgatgaatgtaaaagaagatacaatataaagctttggaagactttcactgactgcttc
aactgcttacctgttgctgcagttatagatgaaaaaatcttctgtatgcatggtggttta
tctcctgaacttactaatcttgaataaatccgtcgtattattagacccactgatgttccc
gatactggtttattatgcgatttactttggagtgatcctgataaagatgtatagggttgg
gcagaaaatgaaagaggtgtttcttatgtatttagtccagaaatagtatcagtattcctg
aaaaagcatgagttagatttgatatgccgtgcacattaggttgtagaagatggatatgaa
ttctttgctaaaagataattagtaaccttattctcagctcctaattattgtggtgaattt
gataacgcaggtgctatgatgactgtagatgaaactttgatgtgttctttctaaattttg
aaacctgctgatagcagaactactggataagctggcagaccttatactcctcctaaaagc
aagtga

DBGET integrated database retrieval system