KEGG   Tetrahymena thermophila: TTHERM_00238850Help
Entry
TTHERM_00238850   CDS       T01020                                 

Definition
Phosphatidylinositol-specific phospholipase C, X domain containing protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
tet  Tetrahymena thermophila
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    TTHERM_00238850
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    TTHERM_00238850
Enzymes [BR:tet01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     TTHERM_00238850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 850 aa AA seqDB search
MSDPQLNSRQLLSKSFSPITKDKALNCISYGLAVNYGSDKKKFIAYQNEVDPELLMLLPY
NQAVPSKLDFIDLTQVIDIQELSPFEKTLNTQWLMLELKNKKHYFSFNDQEEKNLLWQAI
LNIIKSANVSKQQNMKADYVKQMALDFFSKADQDLSDNLTYEECLNLIQKLNVNISKKDL
LEKFQFYDENNDKLLQVNEFVEIIRDLLSKSELMPLFKKYVPSFNEKSNLNSPAMKKETF
FKFMKAEQKQEEIDLKSQQFLDMYFAEKNNIISYNDFINLIFNYQNNIYDPAKLSVYQDM
DQPLTDYFINSSHNTYLMANQLTGESNVQAYINAFRKGCRCIEIDVWDGSEPIVTHGFTL
TSSIKFRDVVQTIKTYGFVWSKYPIIISIENHCNQENQKKMANIMKEIFGSSIYLIPENY
SSMKFYPSPRQLKKKIIIKAKGTLSQILEESVQTVDLQLKKQSKSTPHQSRRIRDSVLFS
NIHQQDQIDLNQIYHFNIEKAFSQNDVDDNTNMLYYSPMQLLQISESNRQFKSIQYDQED
TERTIMDSDDETDSKSQVAQVKDFQRCISMVGVSFTMDMIKFQNGSIFDIFSLSEEKIKY
LLKKHEKIIVDYHKKFFSRIYPKGSRVDSSNFDPLPSFISGSQIIALNFQTCDYHMLMYL
SKFQQNGGIFSGYVLKPKYLRHSHIQQINSDDHKLCDDLNKNKNTLQKYPSDFVKQIKEI
KITIISGQCLKREEDDSKSFNPFIEVSLKGTELDEKNNKTQRTKSINNNTFHPIFNSSPI
TFKVACPELAMISFQVFSNGIIKNELFAQYALDFECIREGYRIIPLWDKEFKKIEHGMLL
AHIEILDLYT
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacccttaattgaactcacgttagctcttaagcaaatcttttagtcctataaca
aaagataaggctttaaattgcatcagttatggattagcagtaaattatggttcagacaaa
aagaaattcattgcctattaaaacgaagttgatccagaactattgatgcttttaccatac
aattaagctgtaccttccaaattagattttatagatttaacataagtaatagatatttaa
gagttatctccgtttgagaaaactctgaacacttaatggctgatgttagagctaaagaat
aaaaagcattattttagttttaatgattaggaagagaaaaatctactttggcaagctatc
ttaaatattatcaagtcagcaaatgtctcaaagcaacaaaacatgaaggctgattatgtc
aagcaaatggctttagattttttttccaaggctgattaagatttatctgataatttaact
tatgaagaatgcttaaacttaatataaaaactgaatgtgaacattagcaaaaaggatctg
ttggaaaaattctaattttatgatgaaaacaatgacaaacttctccaagtgaatgagttt
gtagagattattagagatttactttcgaaaagtgaattaatgcctttgtttaagaaatat
gtgccttcttttaacgaaaaaagtaatcttaactcacctgcaatgaaaaaagaaacattc
ttcaagtttatgaaagctgaacaaaaacaagaagaaattgatctgaagtctcaataattt
ttagatatgtatttcgctgaaaaaaacaatataatttcttacaatgactttataaatttg
atctttaattattaaaataatatttatgatccagcaaagcttagtgtttattaggatatg
gaccaaccactaacagattatttcataaattcatcccataatacatatctcatggccaat
taactaacaggcgagtctaatgtataggcatacattaatgcttttagaaaaggctgtagg
tgtatagaaatcgatgtgtgggatggaagtgaaccaatagttactcatggttttacttta
acatcatccataaagtttagagatgttgtttaaaccattaaaacttatggatttgtctgg
agtaaataccctatcataatttctatagaaaaccactgtaaccaagaaaattagaaaaaa
atggcaaatattatgaaagaaatatttggaagctcaatatatcttatccctgaaaattat
tcatccatgaagttctaccctagtcccagatagcttaaaaaaaaaataattatcaaagct
aagggaacactaagccaaattttagaagagtcagtttaaactgtagatttatagttgaaa
aagcaaagtaaaagtactccacactagagcaggagaattagagattctgttttgttttct
aatattcactaacaggattaaatagatttaaaccaaatctatcactttaatattgaaaaa
gccttttcttagaatgatgtagatgataacacaaatatgctatattattcacctatgtaa
ctattgtaaatttcagaatctaacaggtagtttaaatcaatctagtatgactaagaagat
acagagagaacaattatggacagcgacgacgagactgacagcaagtcttaagttgcataa
gtcaaggatttttagagatgtatttccatggtaggtgtgagctttacaatggatatgatc
aaattctaaaatggctcaattttcgatatattttcgctaagcgaagaaaaaattaaatac
ttgctaaaaaagcatgaaaaaattattgttgattaccataaaaaatttttcagtcgtatt
tatccaaagggttcgagagtagattcttcaaatttcgatcctttaccatcatttataagt
ggatcttaaattattgcacttaatttttaaacttgtgattatcatatgctaatgtatctt
tctaaattctagtaaaatggtggaatttttagtggatatgttttgaaaccaaagtattta
agacatagtcacattcaacaaatcaattcagatgaccataaactatgtgatgatttgaac
aaaaataaaaatactttgcaaaaatatccaagtgactttgtaaaacaaataaaagaaata
aaaattactattattagtggatagtgcttaaaaagggaagaagatgattcaaagtcattt
aatccgttcattgaagtttctttaaagggtacagagctagatgaaaaaaacaacaaaact
taaagaactaaatcaataaataataatacatttcatcctatttttaattcttctcctatc
acttttaaagttgcatgtccagaacttgcaatgatttcattttaagtatttagtaatgga
atcataaaaaatgaattattcgcatagtatgcccttgattttgagtgtataagagaaggc
tatagaataataccattatgggataaagaatttaaaaaaatagaacatggtatgttgctt
gcacatattgaaatattggatttatatacatga

DBGET integrated database retrieval system