KEGG   Tetrahymena thermophila: TTHERM_00241600Help
Entry
TTHERM_00241600   CDS       T01020                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
tet  Tetrahymena thermophila
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tet00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 432 aa AA seqDB search
MVKIIVKISIIICLIYFANAYFGKITFFFFLQNNFIKFNQGSCFSERRLTALNRTSIFEK
ISEQKPDVFAWLGDFGYPKLFEDFIPAFEFTKNEKGYKMLQSNNITQIIGVWDDHDYGRN
DGDKNYKHKHETRQIYLDYIGEPKNSIRRTQPGGIYTSYYLGSTKKVKLVLLDVRFSRDS
FWFEHSDILGPDQWKWLENEFNDPHSHTIILASGCQILPDDRVIPEKWYPDSRNRLFNLI
QKHKDHQRVILISGDIHLAEILVEPNSVNKFGYNIIEITSSGLTHHIMDYKFPQFIVDGF
LPNTFNDRQHRLMDFNYALVDIKIDPENKENTQLEISIKDQNNATRLQVKIEPWKQEQKQ
LNLTNSKYTRDDHRYKRWIIWMFKNYFIEYRKAGIALTSIAFVILILAYFICKILYDCYQ
NKIKNQQKQKTN
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggttaaaataattgtaaaaatatcaataattatatgcttaatctactttgcaaacgca
tactttggtaaaattacattctttttctttttgcaaaacaatttcattaaatttaatcaa
gggtcttgcttttccgagagaagattgactgctttaaatagaacttctatatttgaaaaa
atatctgaataaaaacctgatgtgtttgcttggttaggagattttggttacccaaaatta
tttgaagattttataccagcctttgagtttactaaaaacgagaaaggttataaaatgctt
taaagtaataacattactcaaattattggtgtttgggatgatcatgattacggaagaaac
gatggagataagaactataagcataaacatgaaacaaggtaaatttatttagactatatc
ggagaacctaagaatagcattagaagaactcaacctggtggtatctatacctcttattat
cttggaagtacgaaaaaagtcaaattagttcttcttgatgttagattttcaagagattca
ttctggtttgagcactcagacatattaggtcctgattaatggaaatggcttgaaaatgag
ttcaatgaccctcattctcatacaataattttagctagtggatgctaaatactaccagac
gatagagttattcctgagaagtggtatcctgatagtagaaacaggttatttaatttgatt
taaaaacacaaagaccatcaaagagtcatattaataagtggagatatacacttagcagaa
atacttgttgaacctaattcagttaataaatttggttataatatcattgaaatcactagt
agtggtctcactcatcatatcatggactataaatttcctcaatttattgttgatggattt
ctgccaaacacttttaatgatagacaacatagattgatggattttaactatgccctagtt
gacataaaaattgatccagaaaataaagaaaacacataattagaaattagtataaaagat
caaaataatgctactagattgtaagttaaaattgaaccatggaaataggaataaaagtag
ttaaacctgactaactcaaaatatacaagggatgatcatcgttataaaagatggattatt
tggatgttcaaaaactattttatagagtatagaaaagctggaatagctttaactagtatc
gcttttgtaattttaattttggcttactttatctgcaaaatattgtacgattgttaccaa
aataaaataaaaaattaacaaaaataaaagacaaactga

DBGET integrated database retrieval system