KEGG   Tetrahymena thermophila: TTHERM_00245080Help
Entry
TTHERM_00245080   CDS       T01020                                 

Definition
Ubiquitin carboxyl-terminal hydrolase, family 1 protein (EC:3.4.19.12)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
tet  Tetrahymena thermophila
Brite
Enzymes [BR:tet01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TTHERM_00245080
Peptidases [BR:tet01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   TTHERM_00245080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 232 aa AA seqDB search
MAEEQGDNWFPLESNPDVINPYVQGLGFDTAQYSWCDLLSVEEWAQEMVPKPCLAVVFLY
PISENTTKYDQEEENQEQQVHQSVYFMRQYARNACGTVAVMHAMLNIDPSLVSANSVVDR
FRQATREMTPEQRGNYFLTCNDLKQNHQQAVQQGQCSIQEEVDTHFIAFIQKEGHIYELD
GRKKTPINHGQSSPDTFLQDACVVAKKLMDRDPSQLNFTLVALAKTQNEQEQ
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagaataaggtgataactggttccctcttgaatcaaaccctgatgttattaat
ccttacgtataaggtttaggatttgacacagcataatattcatggtgtgatttactttca
gtagaagaatgggcttaggaaatggtcccaaaaccatgcttagcagttgttttcttgtat
ccaattagcgaaaatacaacaaaatatgatcaagaagaagagaactaagaataataggtt
caccaaagtgtttatttcatgagacaatatgctagaaatgcttgtggtacagttgcagta
atgcatgctatgttaaacatcgatcctagcttagtatcagctaactctgttgtagataga
tttagataagctactagagaaatgactcctgaataaaggggaaattactttttgacatgc
aatgacttaaaataaaatcattaacaagctgtttagtaaggttaatgtagcattcaagaa
gaagttgatactcattttattgcttttatccaaaaagaaggacatatttatgagttagat
ggaagaaagaaaactcccattaatcatggataaagttctcctgatactttccttcaggat
gcttgtgttgttgctaaaaagttaatggacagagatcctagctaattaaactttactttg
gttgctttagcaaaaacacaaaatgaataagagtaatga

DBGET integrated database retrieval system