KEGG   Tetrahymena thermophila: TTHERM_00248390Help
Entry
TTHERM_00248390   CDS       T01020                                 

Definition
histone acetyltransferase gcn5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
tet  Tetrahymena thermophila
Brite
Enzymes [BR:tet01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TTHERM_00248390
Transcription machinery [BR:tet03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     TTHERM_00248390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
Structure
PDB: 

Jmol
AA seq 418 aa AA seqDB search
MADQEKSAQDAQNAAPQETAFVGMNGEETGLGFATRDQGAKVEEDQGLLDFDILTNDGTH
RNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNKQKVIGGICFRQYKPQRF
AEVAFLAVTANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADNFAIGYFKKQGFTKEHRM
PQEKWKGYIKDYDGGTLMECYIHPYVDYGNISQIIKRQKELLIERIKKLSLNEKVFSGKE
YAALIQNSMDNEDPENPKVNPSDIPGVAFSGWEWKDYHELKKSKERSFNLQCANVIENMK
RHKQSWPFLDPVNKDDVPDYYDVITDPIDIKAIEKKLQNNQYVDKDQFIKDVKRIFTNAK
IYNQPDTIYYKAAKELEDFVEPYLTKLKDTKESNTPSNNNSAHGSKKPLPVRKSIKKK
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggctgattaagaaaaatctgcttaagatgcatagaatgcagcaccataagagactgca
tttgtaggaatgaatggtgaagaaactggacttggatttgcaactcgtgattaaggagcg
aaggttgaagaagattagggtcttttagattttgacattttgactaatgatggtactcat
agaaacatgaaactgcttatagatttaaagaatattttctctcgttagttgccaaaaatg
cctaaagaatatattgttaaattagtatttgatagacatcatgaatcgatggtgatatta
aagaataaataaaaagttattggtggtatctgctttcgttaatataagccttaaagattt
gcagaagtagctttccttgctgtcactgcaaatgaataggttagagggtatggcacaaga
ttgatgaataaatttaaagatcatatgtaaaaatagaatattgaatatcttctcacttat
gctgataactttgctattggatactttaagaaataaggttttacaaaagaacatagaatg
ccataagaaaaatggaagggatatattaaagattatgatggcggtactcttatggagtgc
tacattcacccatatgttgattacggaaatatatctcagatcatcaaaagataaaaagag
cttttgatagaaagaatcaagaaattatcattaaatgaaaaagtattctctggtaaagag
tatgctgcattaatataaaattctatggataatgaggatcctgaaaaccctaaagtgaat
ccttcagatattcctggagttgcatttagtggttgggagtggaaagactaccatgaactc
aagaaatcaaaagagagatcattcaatctttagtgtgctaatgttattgaaaatatgaag
agacacaaacaatcttggcccttcttagatcctgttaataaagatgatgttccagattat
tatgatgtgattactgatcctatagatattaaagcaatagaaaagaagttataaaataat
caatatgttgacaaagactaatttatcaaagacgtcaaaagaatttttactaatgctaaa
atttataactagcccgatactatatattataaagctgctaaagaattagaagattttgtt
gaaccttatcttactaaacttaaagatactaaagaaagtaatactccatctaataataat
tctgcacatggaagtaagaaaccacttcctgttagaaaaagtataaaaaagaaatga

DBGET integrated database retrieval system