KEGG   Tetrahymena thermophila: TTHERM_00265180Help
Entry
TTHERM_00265180   CDS       T01020                                 

Definition
(RefSeq) Serine/Threonine kinase domain protein
  KO
K08857  
NIMA (never in mitosis gene a)-related kinase [EC:2.7.11.1]
Organism
tet  Tetrahymena thermophila
Brite
Enzymes [BR:tet01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     TTHERM_00265180
Protein kinases [BR:tet01001]
 Serine/threonine protein kinases: Other group
  NEK family
   TTHERM_00265180
Protein phosphatases and associated proteins [BR:tet01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TTHERM_00265180
Chromosome [BR:tet03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    TTHERM_00265180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 840 aa AA seqDB search
MADKQYMNIHVLVAEDDNFQRLALIDILTLCDYQVTAVENGRLARDELLKQDSNIDIVLL
DLYMPEMDGFELLSLMQEHENLQKIPVIMMSSDKEEEKVATCIAKGAKDYIFKPLRVQNV
KAIAKYVQYKDQGDKNSNLVGIQQYKVLKTLGQGASGSVELVQKNDGNLYALKTISMKYM
NDTEKRSAQSEVTLLKVLVAPTIIRYYEAFVQNDSIYIVMEYAKEGALSDKIQEHKTKGI
RIDEETILYFTAQIVIALFFMHQKKILHRDIKSQNLFLTKENVVKLGDFGISKALGTNAD
FTKTLVGTPYFMSPEVCAGQSYGDKADIWALGCTLYEMVMLRRPFDCENINTLFTMIRQQ
DPSPLHDNCSTDIRMLITLMLNKDPLKRPFIWDLVNIPIINKNIRKYHQQEAPDDPFLIE
LLKRPTSGNPLSMPNTPSNSNSSTQPPANSNSVANNNSNVSNNPQEAQCNTLEQISKAMS
EELKPYDQKTGMFHVERNVINGKQIFDWFNKYYPNYQTSQLVELLQNLVEKKYIHHISGP
QYEANVNSLFRFQFDMPGIPQNYYKIWSKQARAPSDIMQEIIQQANFVLQEICEQYTGVI
SEDKLIQSKKYTKFQEMVCELQKIYLQDLTQEDQRKSFFLNLIQIMQFHQFMKEKYDHKR
NEQKKNVSTILDLIQSFLPFFKKQQKFEYRIGHQTFSIEDVKHGILRCNKKHKGSSFRPF
TGSDDKYQLIQQQDLRVLILFKEENASPSPLLFITPETFEEQLNQLCAKFMSRFVCYDRV
ENDLTLHKIFQIYQNDFGKDQSDTIKWASKYTKGIGNVNDLISSIQQGEVFIQFQEKFEI
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaataatacatgaatatacatgtcctcgtagcagaggatgacaatttctaa
aggttagctcttatagacattttaactctatgcgattattaggtcactgctgtggaaaat
ggcagattggctagagatgagcttctgaaataagattcaaatattgacatagttttatta
gatttatatatgccagaaatggatggatttgaattattaagtttaatgcaagaacatgaa
aatttacaaaagattccagttatcatgatgagttcagataaagaagaagaaaaggtggca
acatgtattgcaaaaggagcaaaagattacatattcaagccactaagagtacaaaatgta
aaagctattgcaaaatacgtacagtacaaagattaaggagataaaaattctaatctagtc
ggaatttaataatataaggttcttaaaacattaggttaaggtgcttcaggaagcgtagag
ttagtgtaaaaaaatgatggaaatttatatgcattaaagactatatccatgaaatatatg
aatgatacagaaaaaagatctgctcaatcagaagttactttgctaaaggtcttagttgca
ccaactattattcgttattatgaagcatttgtctaaaatgattcaatttatatagttatg
gaatatgcaaaagaaggagccttaagcgataaaatacaagagcataaaactaaaggcata
aggatagatgaagaaactattctttactttactgcatagatcgtcatagctttgttcttt
atgcattaaaagaaaattcttcatagagatattaagtctcaaaatctttttttaactaaa
gaaaatgtagttaagctaggagactttggtatttctaaagctcttggaacaaatgctgat
ttcactaaaaccttggtaggaactccttattttatgtctcctgaagtgtgtgctggttaa
tcttatggagacaaagcagatatttgggctttaggttgtactctatatgaaatggtcatg
cttcgtagaccttttgattgtgaaaatataaacactctctttactatgatcagataataa
gacccttctcctttgcacgataactgcagtacagacattagaatgctaattactctcatg
cttaacaaagatccactaaaaagaccatttatttgggatttagtaaacattccaatcata
aataagaatattagaaaatatcattagcaagaagctcctgatgatccctttttgatagaa
ttattgaaaagaccaacttcaggtaatcctctttcaatgcctaatactccatccaactct
aactcctccacttaaccgccagctaactctaactcggtagcaaataacaactcaaatgtc
tctaacaacccataagaagcataatgtaatactttagaataaattagtaaggctatgagt
gaagaattaaaaccttacgaccaaaaaacaggaatgtttcatgtggaaagaaatgtaatc
aacggaaaacaaatttttgattggtttaataaatattatccaaattatcaaacttctcag
cttgtagaattactctaaaatttagtagaaaagaagtatattcatcatatatcaggtcca
cagtatgaagcaaatgttaattcattattcagattctaatttgatatgcctggtatacct
taaaactattacaaaatatggagcaaataagcaagagcacctagtgatataatgtaagag
ataatttaataggctaatttcgttctctaagaaatttgcgaataatacacaggagtgata
tcagaagataagcttatccaaagtaagaaatatacaaaattctaggaaatggtgtgtgaa
cttcaaaaaatttacttgcaagaccttacttaagaagattaaagaaaatctttcttcttg
aatctgatttaaataatgtaatttcaccagtttatgaaagaaaagtatgaccataaaaga
aatgaataaaaaaaaaatgtatcaacaattctagatttgatctaatcatttcttccattc
tttaaaaaataataaaaatttgagtacagaattgggcattaaactttttctatagaagat
gtgaaacatggaattctaaggtgtaataaaaagcataaaggaagtagcttccgtccattt
actggaagcgatgataaatatcagctcatttaatagtaagatttaagagttcttattctt
tttaaagaagaaaatgcttcaccttcacctttgcttttcataacacctgaaacatttgag
gagcaactgaatcaactttgtgctaaatttatgagcagatttgtttgctatgatagggtt
gagaacgatctaactttgcataaaatattttaaatatatcaaaatgactttggaaaagat
taatctgatacaataaaatgggcttcgaaatatactaagggtataggaaatgtaaacgat
ctcatatcaagcatttaacaaggagaagtctttatataattctaagaaaagtttgaaatc
tga

DBGET integrated database retrieval system