KEGG   Tetrahymena thermophila: TTHERM_00275740Help
Entry
TTHERM_00275740   CDS       T01020                                 

Definition
(RefSeq) clathrin heavy chain
  KO
K04646  
clathrin heavy chain
Organism
tet  Tetrahymena thermophila
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:tet00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    TTHERM_00275740
Exosome [BR:tet04147]
 Exosomal proteins
  Proteins found in most exosomes
   TTHERM_00275740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 1727 aa AA seqDB search
MQGGVPIRVQTVASLTQLGVGSEYLKFNQTSFQSDRTICINDKNAQGQNQLTQIQVDNNF
SVNRKPNKAEYSLNHPTKNILSMRAPSPNGVGCYVQIYNLDNREKLKHIDLNENIVYMTW
VNNNILAMVTPTKVYHSDLTSQAPSTVAFERAGNLANPNCQIIGYKVNTQGNWAALYGIS
SPDQRQINGDIQLYKLDENSQQPLTGHCCCFGQAKIHNDTHLSDIFAYYDRKPGDTVAKI
LLRELSAPPEGFQKYKGAAEYPFNAQFPADFPIYMQVCTKYGQLFCLSKSGFLFVYELTT
SALIYQQKVTDSSIFVATQDSKEDGIYAIAKNGNVILIQIDPSQLVPHLQRQQNIPNVVQ
VAFKLASRYRLPGADGMFMDQFNRFMMAGDYANAAQIAAGAPGELIRNAQTIAKFKQLQG
TPSPLLVYFQTLIQKGTLNQLESYELAQFLLSQNKMTAVEKLMNENKLEYSEGLGDLIAT
QNPNSALEVYKKSGSHLKVISTLGGLGRIDEADKYARLNNLSQINYTEVIRSTVLTNPQQ
AVTLAKTQVATNPSTNVHQIAEIFGQAGKFKEMSAFLVDCMKQNRPEDGPWQTKVLEWNI
INEPNIVDPIFDLTKWNQYNRLRIAQLCEQKQLYQRALENYSDIKDIRRVCLNTHMIQPA
WLVNYFSNVQTDWALACMQDLLKHNRQNLPLVVEACAKNYQKFTVQSCIKCFESVGSFDG
VYTFLSQIINSTEDKDIHFKYIEAATKCNQLRIVEQVIQEKANCYDPVKVKDFLKGLRLQ
DPKPLIFLCDIHKYIDELTAYLYQNNFLNYIQIYLFQVNPQAAPIVLGTLIDQECEERQI
QIILQQIAGKLIPQCYEPLIEEFEKRNKLRVLESWLEGRCNEGNQIPAIHNALAKIKIDT
NQDPETFLQNNQFYDAKVVGKFCEERDPHLAVIAYKRSWGQCDEELIMVTNKNALFRLQA
RYLVERQSKELWASVLTPDNPYRKQVIEQVVQSALPESKDVDQVSTAVKAFMDAELPEHL
ITLLEKIVLHNHEFGQYKKLQNLLIITAIKSDKTKVMDYINRLDNYDGPEIAKIALGDPY
QLYEEAYIIYVKFNQPVSAIEVLINNIDDIPRAAEYAQKVNNPEVWSKIANAYLDRSQIT
EAIDSYIKAKDHTMYLQVISAAEIDGKFDQLIKYLLMARENIKDAQIDNALVFAYAKTEK
ITDLENFISNSNSVDYQRVGDRCYDEKHYEAAKLLFTATKNNAKIASCLVRLKQFQQAID
AAKKANTPKTWKELTMACVEAAEFKLAAVAGLNIIIHPDHLEELAQYYEEFGYSNEMISL
LETGMGLDRAHVGIFTELGVLLAKYRPERLMEHCKQYYSKMNISKLLRVCERYQHWSEAV
FLHSNYDQYDNAINIMIEHSPVAFNHDQFVNLLIKASNYDLYYKAILFYLDEQPEQVNEL
LRSLTTKIDLSKCVSVMRKTGYIALITPFLKSVQNANNKEVNEILNEIYLESFDYENLRQ
SITTYENFDQLTLAQNCERHTLLEFRRISAYLYRRIQKYEFSIALSKQDNIYRDAIETAQ
ESGKVELVEDLLKFFVQKGEKEFITVTLYTCYELIRPDLAMEYAWRFNLFEFIMPYFIQI
TKELTSRVDTVQKKHEKREKEEEKKANQQLNQGMFMPTHDILPTALMIGPPPGSMPGMNM
PPMGGMPPMGGMPPMGGIPPMGGMPPMGGMPPMGGMGGFGTNPFGPQ
NT seq 5184 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggaggcgttcctattagagtttagacagttgcttccctaacccaattaggagtt
ggttctgaatatcttaagttcaattaaacaagcttttagtcagatagaactatttgcatt
aatgacaagaatgcacaaggataaaaccaattgacatagatttaggttgacaacaacttc
agcgttaatagaaaacccaataaagctgagtacagtttaaaccatcctacaaagaatatc
cttagtatgagagctcctagtcccaacggagtaggctgttatgtttaaatctataactta
gacaacagagaaaagctaaaacatattgatttaaatgaaaacattgtctatatgacttgg
gttaacaataacatattagcaatggttactcccaccaaggtttatcatagtgatcttact
tcccaagctccttcaacagttgcttttgaaagagctggtaatttagctaaccccaactgt
tagattattggttataaagttaacacctaaggtaattgggctgccttatacggtatctct
tctcctgattagagacaaattaatggtgatattcaattatataagcttgatgaaaacagt
taataacctttaactggtcactgctgttgcttcggataggctaaaattcataatgatact
cacctttcagatatttttgcttattatgatagaaaacctggtgacactgttgctaaaatt
cttttaagagaattatcagctcctcctgagggtttctaaaaatataagggagctgctgaa
tatcctttcaatgcctaattcccagctgatttccctatttatatgtaagtttgcactaaa
tatggttaacttttctgcttgagcaagagcggtttcctctttgtttatgaattgactacc
agcgcccttatctatcaataaaaggttactgattcttctatctttgttgccactcaagac
tctaaagaagatggtatctatgctattgctaaaaacggtaatgtaattcttatataaatt
gacccttcttaactagttcctcacctctaaagataataaaatattcctaatgtcgtctaa
gttgccttcaagcttgcttctagatatagactccctggagctgatggtatgttcatggat
taattcaatagatttatgatggcaggtgattacgctaacgctgcttaaattgctgctggc
gctcctggtgaattaattagaaatgcttaaactattgctaaatttaaataactttaaggc
actccctcccctcttcttgtttatttctaaactttaatctaaaagggtaccttaaactaa
ttagaatcttacgaacttgctcaattcctcttgagctagaacaaaatgactgcagttgaa
aagttaatgaatgaaaataagcttgaatactctgaaggtttgggtgatttgattgccacc
taaaatcctaactcagctcttgaagtttacaagaaatctggttctcacttaaaggttatt
tctaccttaggaggtttgggtcgtattgatgaggctgataagtacgctcgcttaaataac
ttaagctaaattaactacactgaagttattagatccactgtcctcaccaacccctaataa
gcagttacccttgccaagacttaagttgccactaatcccagcactaatgttcatcaaatt
gctgaaatctttggttaagctggtaagttcaaggaaatgagtgcattccttgttgactgt
atgaagtaaaacagacctgaagatggtccttggtaaactaaggtccttgaatggaatatc
ataaatgaacctaacattgttgaccccattttcgatttaaccaaatggaatcaatacaac
agattacgtattgcttaactatgtgaataaaagcaactctactagagagcccttgaaaat
tactctgacatcaaggacatcagacgtgtctgccttaacactcatatgattcaacctgct
tggctcgttaattatttcagtaatgtccaaactgattgggctcttgcttgcatgtaagat
ttattgaaacataacagataaaatctcccattagttgttgaagcttgtgccaagaactat
taaaaattcactgtttaaagctgtatcaagtgcttcgaatctgttggttcattcgatggt
gtctataccttcttaagttaaattattaactctactgaagacaaggatatccatttcaag
tatattgaagccgccaccaagtgcaactaattgagaattgttgaataagttatttaggaa
aaggctaactgttatgatcccgttaaggttaaggatttcttaaaaggcttacgtttacaa
gatcctaagcctcttatcttcctttgtgatattcataaatatattgatgaattaactgct
tatctttaccaaaacaatttcttgaactacattcaaatttacttgttctaagtcaatcct
caagctgcccccattgtcttgggaactttgattgatcaagaatgtgaagaaagataaatt
caaatcattttacaacaaattgctggtaaattgattccttaatgctacgaacccttaatt
gaagaattcgaaaagagaaacaaactcagagttcttgaaagctggcttgaaggaagatgc
aacgaaggaaactaaattcctgctatccataacgctttagctaaaattaagattgatacc
aactaggaccctgaaactttcttacaaaacaaccaattctatgatgctaaggttgttggt
aagttctgtgaagaaagagatcctcacttagctgttattgcttacaagagatcttggggt
caatgcgatgaagaattaattatggtcactaacaagaacgctctcttcagactttaagct
agatatttggttgaaagacaatccaaggaattgtgggctagcgttttaactcctgacaat
ccttacagaaagtaagtcattgaataggttgtttaaagtgctcttcccgaaagcaaggat
gttgactaagtttctactgctgtcaaggccttcatggatgctgaacttcctgaacattta
attaccttattggaaaagattgtccttcacaaccacgaattcggtcaatacaagaagctc
caaaacttattgatcatcactgctattaagagtgacaagaccaaggttatggattacatt
aaccgtcttgataactatgatggacccgaaattgctaagattgctttgggagatccttac
taactctatgaagaagcttatattatttatgttaagttcaatcaacctgtctctgccatt
gaagtccttattaacaatattgatgacatccctagagctgctgaatatgctcaaaaggtt
aacaaccctgaagtatggagcaaaattgctaatgcctatcttgaccgttcccaaatcact
gaagctattgattcctacattaaggctaaggaccacactatgtacctccaagtcatcagt
gctgccgaaatcgatggtaagttcgatcaactcattaagtatctcttgatggcccgtgaa
aacattaaggatgcttaaatcgataacgctctcgtctttgcctacgctaagactgaaaag
attactgatcttgaaaacttcatttctaattccaattctgtagattaccaacgtgttggt
gatcgttgttacgatgaaaagcactatgaagctgcaaaattgctcttcactgctactaag
aataatgccaagattgcatcctgtctcgttagattaaaacaattctaacaagctattgat
gctgctaagaaagctaatacccccaagacctggaaggaattaactatggcctgtgttgaa
gctgctgaatttaaacttgctgctgttgcaggtctcaacattatcattcatcctgaccat
cttgaagaattagcttaatactatgaagaatttggctactcaaatgaaatgatctcttta
cttgaaactggtatgggtcttgatcgtgcccacgtcggtatcttcaccgaattaggtgtc
cttcttgccaagtacagacctgaaagacttatggaacactgcaagcaatactactctaaa
atgaacatctccaaattacttagagtttgcgaaagatactaacactggtctgaagctgtc
ttcttgcactctaactatgattaatatgataacgctatcaacattatgattgaacactca
cctgttgcttttaatcatgatcaattcgttaatcttttaattaaggcttcaaattacgat
ttatactataaagctattctcttctatttagacgaacaacctgaataagtcaacgaactt
cttagatctctcaccactaagattgacttgagcaaatgtgtctctgtcatgagaaagact
ggttatattgctttgattacccccttcttaaaatccgtataaaatgctaataacaaggaa
gttaatgaaatcttgaatgaaatctacttagaaagcttcgattacgaaaatctccgtcaa
tccattacaacatatgaaaacttcgatcaactcactttggcttaaaattgtgaacgtcac
actttattagaattcagaagaatttctgcttatctttacagacgtattcaaaagtacgaa
ttctctattgctctctctaagcaagataacatttacagagatgccatcgaaactgcttaa
gaatctggtaaggttgaattagtagaagatctccttaaattctttgtctaaaagggtgaa
aaggaattcattactgttactttatatacttgctatgaattaatcagacctgatttggct
atggaatatgcttggagatttaacttatttgaatttattatgccttacttcatctaaatt
actaaagaacttacttctagagttgatacagtataaaagaagcacgaaaaacgtgaaaaa
gaagaagaaaagaaagctaattaataattaaactaaggtatgttcatgcctacacatgat
attttaccaactgcacttatgattggacctcctcccggttctatgcctggtatgaatatg
cctcctatgggtggtatgccccctatgggtggtatgcctccaatgggcggaatacctcca
atgggtggaatgcctccaatgggtggtatgcctcctatgggtggtatgggtggtttcggt
acaaaccccttcggtccttaatga

DBGET integrated database retrieval system