KEGG   Tetrahymena thermophila: TTHERM_00283890Help
Entry
TTHERM_00283890   CDS       T01020                                 

Definition
(RefSeq) L-isoaspartate O-methyltransferase
  KO
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tet  Tetrahymena thermophila
Brite
Enzymes [BR:tet01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     TTHERM_00283890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 262 aa AA seqDB search
MKLITLSQKIKRSNTLQNQLVFLLQKNFIMSNKRHNKSQKELVEELIQRGTIKTQEVELA
MLSVDRSDFINKDPYLDIPQQIGYNVTISAPHMHAFSLSYLQRHLISGKPVRVLDIGCGT
GYLCPAFLKMIPVQFQQQSTIVGIDHVKDLVQLSDRNIRKSFSQELDKKQIILVTGDGRE
GYQQLAPYDAIHVGAAAEKIPEALLQQLNFGGRMLIPVGKHGGEQEFLAIDKDLQGKITQ
TRLFGVSYVPLTSIQKQLGTQK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgattactttatcacaaaaaattaagagaagtaatactttataaaattaacta
gtttttttacttcagaaaaacttcatcatgagcaataagagacataataaaagccaaaag
gaattagttgaggaactaatttaaagaggtaccattaaaacataagaagtagaattagct
atgctttcagtcgatagatctgattttataaataaagatccatatttagacattcctcaa
taaattggatataatgtcactatctctgctcctcatatgcacgcttttagtttgtcatat
ttataaagacatctgatttctggtaaacctgttagagtcttggatattggctgtggaaca
ggatatctttgtcctgcatttcttaagatgatacctgtttaattttaataatagagtact
attgtagggatagaccatgttaaagacttggtccagctttcagatcgtaatattagaaag
tcctttagctaagaattagataaaaaataaattattttagtaactggagatggtagggaa
ggttattagcagcttgctccatatgatgctatccatgttggagctgcagcagaaaaaata
ccagaggctttgcttcagtaattaaatttcggaggaagaatgctgataccagtaggtaaa
catggtggtgaataagagtttttagctattgataaagatttataaggtaaaataacatag
actagattatttggagtatcgtacgtaccattaacgagcatataaaagtagcttggaacg
tagaaatga

DBGET integrated database retrieval system