KEGG   Tetrahymena thermophila: TTHERM_00312120Help
Entry
TTHERM_00312120   CDS       T01020                                 

Definition
bifunctional dihydrofolate reductase-thymidylate synthase (EC:1.5.1.3 2.1.1.45)
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
tet  Tetrahymena thermophila
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    TTHERM_00312120
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TTHERM_00312120
   00670 One carbon pool by folate
    TTHERM_00312120
Enzymes [BR:tet01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     TTHERM_00312120
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     TTHERM_00312120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 485 aa AA seqDB search
MKTRHFDIVLAQTLKKQGIGYKNSLPWRLPNELKNFKKITTETKNKGLQNAVIMGKNTWE
ALPKKQQPLKDRLNIVISTTMQEGQIADHSYACKSLDSALNFLEQQNQIQDALVIGGAKL
CQQALSDQRLRQIHLTRVGVEVECDVFMQKDYLKNFDMIEVSETQSENNLNYDFTRYFNK
NYKGQVDPSLFKKMYKPHQEYQYLELIDEIIKNGHVKTDRTGTGTISQFGKLMRFDLSKS
FPLLTTKNVFWRGVVEELIWFIKGSTNSKILSEKGVKIWDGNGSREFLDQLGFKNREEGD
LGPVYGFQWRHFGAEYKDMHTNYKGKGVDQLQDLINTIKKNPDSRRMIMNAWNVKDLPLM
ALPPCHVMSQFYVNDNKLSCMMYQRSCDMGLGIPFNIASYALLTHMIAQVTNMQVGEFIH
VLGDAHVYSNHVDQLKIQLERAPYPFPLLKINNNKQYNSIEDFTLEDFELIGYNYHPKIQ
MKMAV
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaagacattttgatatagttttagcttagactttaaaaaaatagggtataggt
tataagaacagtttaccatggagactacctaatgagcttaaaaactttaaaaaaataact
acagaaactaagaacaaaggcctataaaacgctgttatcatgggtaaaaatacttgggaa
gcactacctaaaaagcaataaccattgaaagatcgcttaaatattgttatttccactact
atgcaagaggggtaaattgcagatcattcctacgcctgtaaaagcttagattctgcttta
aactttttagaatagtaaaattaaatataagatgcccttgtaattggaggagctaaactt
tgccaataagcattaagcgatcagagacttagatagattcatctaacaagagtaggtgtc
gaagttgagtgcgatgtttttatgcaaaaggactacttaaaaaactttgatatgattgag
gtgtctgaaacttaaagcgaaaataatttaaattatgattttactaggtattttaataag
aattataaaggataagttgacccttctctctttaagaaaatgtacaagcctcatcaagaa
tattaatacttagaacttatcgatgaaattataaagaatggacatgttaaaacagacaga
actggaactggtacaatttctcagtttggcaagttgatgagatttgacttatcaaagagt
tttcctctgcttactaccaaaaatgttttttggagaggtgtagtagaagaacttatttgg
tttatcaaaggcagtacaaacagcaaaatactttcagaaaaaggagttaaaatatgggac
ggtaatggcagcagagaatttttagattaattaggctttaaaaacagagaagaaggagat
ttaggtcctgtttatggtttctaatggagacacttcggtgctgaatataaagatatgcat
acaaattataaaggtaaaggtgtcgaccagcttcaagatttaattaacacaataaagaaa
aatcctgacagcagaaggatgattatgaatgcctggaatgttaaagatctaccattgatg
gctttacctccttgtcatgtcatgagctagttttatgtaaatgataataaactaagctgt
atgatgtactaaagatcttgtgatatgggtttaggaataccatttaatatagccagttat
gctttattgactcatatgatagcttaagtcactaatatgtaagttggagagtttatacat
gttctaggtgatgctcatgtttactctaatcacgtagattaactaaaaatttaattagaa
agagctccataccccttccctcttttaaaaattaataacaacaagtaatataactctatt
gaagacttcactcttgaagatttcgaattaattggatacaactatcaccctaaaatataa
atgaaaatggctgtctga

DBGET integrated database retrieval system