KEGG   Tetrahymena thermophila: TTHERM_00312120Help
Entry
TTHERM_00312120   CDS       T01020                                 

Definition
bifunctional dihydrofolate reductase-thymidylate synthase (EC:1.5.1.3 2.1.1.45)
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
tet  Tetrahymena thermophila
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tet00240]
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tet00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:tet00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 485 aa AA seqDB search
MKTRHFDIVLAQTLKKQGIGYKNSLPWRLPNELKNFKKITTETKNKGLQNAVIMGKNTWE
ALPKKQQPLKDRLNIVISTTMQEGQIADHSYACKSLDSALNFLEQQNQIQDALVIGGAKL
CQQALSDQRLRQIHLTRVGVEVECDVFMQKDYLKNFDMIEVSETQSENNLNYDFTRYFNK
NYKGQVDPSLFKKMYKPHQEYQYLELIDEIIKNGHVKTDRTGTGTISQFGKLMRFDLSKS
FPLLTTKNVFWRGVVEELIWFIKGSTNSKILSEKGVKIWDGNGSREFLDQLGFKNREEGD
LGPVYGFQWRHFGAEYKDMHTNYKGKGVDQLQDLINTIKKNPDSRRMIMNAWNVKDLPLM
ALPPCHVMSQFYVNDNKLSCMMYQRSCDMGLGIPFNIASYALLTHMIAQVTNMQVGEFIH
VLGDAHVYSNHVDQLKIQLERAPYPFPLLKINNNKQYNSIEDFTLEDFELIGYNYHPKIQ
MKMAV
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaagacattttgatatagttttagcttagactttaaaaaaatagggtataggt
tataagaacagtttaccatggagactacctaatgagcttaaaaactttaaaaaaataact
acagaaactaagaacaaaggcctataaaacgctgttatcatgggtaaaaatacttgggaa
gcactacctaaaaagcaataaccattgaaagatcgcttaaatattgttatttccactact
atgcaagaggggtaaattgcagatcattcctacgcctgtaaaagcttagattctgcttta
aactttttagaatagtaaaattaaatataagatgcccttgtaattggaggagctaaactt
tgccaataagcattaagcgatcagagacttagatagattcatctaacaagagtaggtgtc
gaagttgagtgcgatgtttttatgcaaaaggactacttaaaaaactttgatatgattgag
gtgtctgaaacttaaagcgaaaataatttaaattatgattttactaggtattttaataag
aattataaaggataagttgacccttctctctttaagaaaatgtacaagcctcatcaagaa
tattaatacttagaacttatcgatgaaattataaagaatggacatgttaaaacagacaga
actggaactggtacaatttctcagtttggcaagttgatgagatttgacttatcaaagagt
tttcctctgcttactaccaaaaatgttttttggagaggtgtagtagaagaacttatttgg
tttatcaaaggcagtacaaacagcaaaatactttcagaaaaaggagttaaaatatgggac
ggtaatggcagcagagaatttttagattaattaggctttaaaaacagagaagaaggagat
ttaggtcctgtttatggtttctaatggagacacttcggtgctgaatataaagatatgcat
acaaattataaaggtaaaggtgtcgaccagcttcaagatttaattaacacaataaagaaa
aatcctgacagcagaaggatgattatgaatgcctggaatgttaaagatctaccattgatg
gctttacctccttgtcatgtcatgagctagttttatgtaaatgataataaactaagctgt
atgatgtactaaagatcttgtgatatgggtttaggaataccatttaatatagccagttat
gctttattgactcatatgatagcttaagtcactaatatgtaagttggagagtttatacat
gttctaggtgatgctcatgtttactctaatcacgtagattaactaaaaatttaattagaa
agagctccataccccttccctcttttaaaaattaataacaacaagtaatataactctatt
gaagacttcactcttgaagatttcgaattaattggatacaactatcaccctaaaatataa
atgaaaatggctgtctga

DBGET integrated database retrieval system