KEGG   Tetrahymena thermophila: TTHERM_00312950Help
Entry
TTHERM_00312950   CDS       T01020                                 

Definition
kinase, pfkB family protein (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tet  Tetrahymena thermophila
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TTHERM_00312950
Enzymes [BR:tet01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     TTHERM_00312950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 337 aa AA seqDB search
MAQNTYSICVVGSGSFDLFLLVNHFPVEGETLQANDSFIKNGGKGANQAVAAAKLGAKTI
FAGQFGQDKYGDGLVEEMSQSGVDMSKVRRLANVQTGQAIITLNKKGENSIIIVGGANTH
YDHLNVLPQEFKDAIQSSRIILLQKEIPLEISKLAAIYAKQHNKLVMLDCGGRDEDIPEE
LLQNIDFISPNQSELKRVMNINSSDHGEITIDEIRQQLLSKYPNLTVVLKEGSKGSAVIT
KTDYLHVDSASLIKPDILNTYKIVDTTGAGDCFTAAFCVEFDKLFPQNGVQYEDALEKYK
KCLLFANCSAFVCITVMGAMPSMPKLESVQQLLSKVQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggcttaaaatacatattctatttgcgtagttggttctggaagttttgatttattcctt
ttggtaaatcacttcccagtagagggagaaactttgcaagcaaatgactcctttattaag
aacggaggtaaaggagctaatcaagcagttgctgctgctaagttaggtgcaaaaaccatt
ttcgcaggatagtttggtcaagacaaatatggtgatggtttggtagaagaaatgtctcaa
tctggtgttgatatgagcaaagtgagaagattagcaaacgtttaaactggttaggctata
attactttaaacaaaaagggagaaaatagtattattattgttggaggtgctaatactcat
tatgaccatttaaatgttctaccttaagaattcaaagatgcaatttagtcaagcagaatt
attcttttataaaaagagatccctttagagattagtaagttagcagcaatttatgctaag
tagcacaacaagcttgttatgctggattgtggtggtagagatgaagatattccagaagag
ttgctttaaaatatagattttatttctcccaactagtcagaattaaagagagtaatgaac
attaactcaagtgatcatggagaaataaccattgatgaaatccgataataactcttaagc
aaatatcctaatttaactgttgtgttaaaggagggttctaagggaagtgctgttattacc
aaaactgattacttacacgtagactctgcttctttaattaaacctgatatcctcaacact
tacaaaattgttgacacaacaggtgcaggtgattgttttactgcagctttctgtgttgaa
ttcgacaagcttttcccttagaatggagtttaatatgaagatgccttagaaaaatataaa
aagtgcttgctatttgctaactgctctgcctttgtttgcattacagtgatgggagcaatg
ccttctatgccaaagctagaaagtgtgtaacaattattgtctaaagtttaatga

DBGET integrated database retrieval system