KEGG   Tetrahymena thermophila: TTHERM_00313290Help
Entry
TTHERM_00313290   CDS       T01020                                 

Definition
(RefSeq) hypothetical protein
  KO
K03144  
transcription initiation factor TFIIH subunit 4
Organism
tet  Tetrahymena thermophila
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:tet00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    TTHERM_00313290
  Replication and repair
   03420 Nucleotide excision repair
    TTHERM_00313290
Transcription machinery [BR:tet03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     TTHERM_00313290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 484 aa AA seqDB search
MKTESNFIINFLREENSKLRQQSREEFRKKQRDFYNELFKNQATVLTVYRCIDQYSQELI
QKMVRLSFHTNLDPNKQETILKRLLDENYPYQEFTKGQSHLAEFDLVNFKEKTINYGFMN
AYLDIVTCGLKTEIDFCKQKKNNMKDYSQLEGKAKNQWKSICNQLMLMAQEINNTSSQSQ
SKYSRLVMDVFRQILSVEPGNLGSGYQKYMEFILEDTNTQIDKILTLYCYQYSRNHKISV
ETAVSFLLTLSNLDITKIYQNTYNNETATFQPRELEFLNDLHSLGMVFKKEILKDRIAFY
ITPVLWQFCYRKIDLKTLNAKITIETNFNVYAYIDQEDPKEIKDSKDTLKDQTEHIEKLL
ASFCDLHYKFPHLIVGQLSEQKTKDQFKNGLTARLLIQFFNKTSDPQMKKYLKDKQMNAI
LLTQVQNLQKKKLEFLNLFKKTEDNFSLIPDNIQQEIETWEREKNYQIRRDDNYNSDEDV
KDKD
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaagactgaaagcaattttatcatcaatttcttgcgagaggaaaatagcaaattaaga
taataatcaagggaagagtttcgtaaaaagtagagagatttctataacgaattattcaaa
aatcaggcaactgttctaacagtgtatagatgtatagattagtattcataggaattgatt
tagaaaatggtaagattgagcttccatacaaacttagatccaaataaataggagaccatt
ctaaaaagattgttagatgaaaattacccctattaagaattcacaaaaggataaagccat
ttagcagagtttgatttagtcaattttaaagaaaagacaataaattatgggttcatgaat
gcgtatcttgatattgttacttgtggattgaaaacagaaatagacttctgcaagcaaaaa
aagaataatatgaaagattattcataactagaaggcaaagcaaaaaattaatggaaatct
atttgcaactaacttatgttaatggcataagaaataaataatacaagctcacaatcataa
agtaaatattcaagacttgttatggatgtattcagataaattcttagcgtagagccagga
aatttaggaagcgggtatcaaaaatacatggagtttattttagaagatacaaatacataa
atagataaaattctaacactttactgttatcagtattctagaaatcataaaatctcagtt
gaaactgctgttagcttcttactaactctctctaatttggatataacaaagatttaccaa
aatacttataataatgaaacagctactttttaaccaagagaattagaattcctaaacgat
ttacactctcttggtatggtattcaaaaaagaaattttaaaagatagaattgccttctat
attactcctgtactttggtaattctgctacagaaagattgatctaaagacccttaatgct
aaaataacaattgaaactaactttaatgtatacgcatatattgattaagaagatcccaaa
gagattaaagattcaaaagacactttgaaagactaaactgaacatattgaaaaattatta
gcaagtttttgtgatttacattataaatttccacatttgattgttgggtaattatctgaa
taaaaaaccaaagattaatttaaaaatggactcactgcaagactgctaatttagtttttc
aataagacaagtgatccataaatgaaaaaatatttaaaagacaaataaatgaatgcaatt
ctcttaacttaagtctagaacctttaaaagaagaaactagaatttcttaacttattcaaa
aaaacagaagataacttttctttgatccctgataatatataataagaaattgagacttgg
gaaagagaaaaaaattatcaaataagaagagatgataattataattctgatgaagatgtt
aaagacaaggactga

DBGET integrated database retrieval system