KEGG   Tetrahymena thermophila: TTHERM_00313290Help
Entry
TTHERM_00313290   CDS       T01020                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
tet  Tetrahymena thermophila
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:tet03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:tet03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 484 aa AA seqDB search
MKTESNFIINFLREENSKLRQQSREEFRKKQRDFYNELFKNQATVLTVYRCIDQYSQELI
QKMVRLSFHTNLDPNKQETILKRLLDENYPYQEFTKGQSHLAEFDLVNFKEKTINYGFMN
AYLDIVTCGLKTEIDFCKQKKNNMKDYSQLEGKAKNQWKSICNQLMLMAQEINNTSSQSQ
SKYSRLVMDVFRQILSVEPGNLGSGYQKYMEFILEDTNTQIDKILTLYCYQYSRNHKISV
ETAVSFLLTLSNLDITKIYQNTYNNETATFQPRELEFLNDLHSLGMVFKKEILKDRIAFY
ITPVLWQFCYRKIDLKTLNAKITIETNFNVYAYIDQEDPKEIKDSKDTLKDQTEHIEKLL
ASFCDLHYKFPHLIVGQLSEQKTKDQFKNGLTARLLIQFFNKTSDPQMKKYLKDKQMNAI
LLTQVQNLQKKKLEFLNLFKKTEDNFSLIPDNIQQEIETWEREKNYQIRRDDNYNSDEDV
KDKD
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaagactgaaagcaattttatcatcaatttcttgcgagaggaaaatagcaaattaaga
taataatcaagggaagagtttcgtaaaaagtagagagatttctataacgaattattcaaa
aatcaggcaactgttctaacagtgtatagatgtatagattagtattcataggaattgatt
tagaaaatggtaagattgagcttccatacaaacttagatccaaataaataggagaccatt
ctaaaaagattgttagatgaaaattacccctattaagaattcacaaaaggataaagccat
ttagcagagtttgatttagtcaattttaaagaaaagacaataaattatgggttcatgaat
gcgtatcttgatattgttacttgtggattgaaaacagaaatagacttctgcaagcaaaaa
aagaataatatgaaagattattcataactagaaggcaaagcaaaaaattaatggaaatct
atttgcaactaacttatgttaatggcataagaaataaataatacaagctcacaatcataa
agtaaatattcaagacttgttatggatgtattcagataaattcttagcgtagagccagga
aatttaggaagcgggtatcaaaaatacatggagtttattttagaagatacaaatacataa
atagataaaattctaacactttactgttatcagtattctagaaatcataaaatctcagtt
gaaactgctgttagcttcttactaactctctctaatttggatataacaaagatttaccaa
aatacttataataatgaaacagctactttttaaccaagagaattagaattcctaaacgat
ttacactctcttggtatggtattcaaaaaagaaattttaaaagatagaattgccttctat
attactcctgtactttggtaattctgctacagaaagattgatctaaagacccttaatgct
aaaataacaattgaaactaactttaatgtatacgcatatattgattaagaagatcccaaa
gagattaaagattcaaaagacactttgaaagactaaactgaacatattgaaaaattatta
gcaagtttttgtgatttacattataaatttccacatttgattgttgggtaattatctgaa
taaaaaaccaaagattaatttaaaaatggactcactgcaagactgctaatttagtttttc
aataagacaagtgatccataaatgaaaaaatatttaaaagacaaataaatgaatgcaatt
ctcttaacttaagtctagaacctttaaaagaagaaactagaatttcttaacttattcaaa
aaaacagaagataacttttctttgatccctgataatatataataagaaattgagacttgg
gaaagagaaaaaaattatcaaataagaagagatgataattataattctgatgaagatgtt
aaagacaaggactga

DBGET integrated database retrieval system