KEGG   Tetrahymena thermophila: TTHERM_00313670Help
Entry
TTHERM_00313670   CDS       T01020                                 

Definition
Ubiquitin carboxyl-terminal hydrolase family protein (EC:3.1.2.15)
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
tet  Tetrahymena thermophila
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 1823 aa AA seqDB search
MSKIVKHNSKLQQKVKKFKINEASEDKDTNEEDDDIQNFEHLDVQKQKKIQSSKQATSSS
SSNYHLANQNNSKLYAQDISFTIDESEEELAIPNQPLKHAFKKKIRNSSQSSSSERDEFA
NLKSNQDAAQRNAKQNNGKKVNNSKGFPAVNYSNQQDYKSAPDMKDSSKYKNKEISSKQD
IQKLSKNFENDQLINKPQKKIKRDTFSSKFVNEEKNQIEGERTNNSDKSIETAINNKENL
KNGSLSNQNQKVLTNFNQQNQNLNEKPSIKALFLEENEDMSTNNKQVKKKDQALHIQVID
LEVSDDERKNVYLQKGEKQQELEQSAIEQKIIKGYSSVSQKKLKQENKLNSSFDSYSNAD
GLSIQAQGSNSSQMDIRSINQVNLLDNGDNDSILCNYSNLDEDQDQNYSNLIGLTSNNLN
NSYMEDEEDDLFDTIKIKKKTNAYEIINQTGDLNKQINTNMRFNHNNSHKSGISSDSSLQ
IHQKSPSKQPARSSFSPIQNMKKDQQNNMSSSNFSHSVSANQLNITSNKKKDAKGQQGLS
SNQSKINIDYQQEELQNISNIEEEIFEVNELPKEKTRILWIFNSVHFIERLTNNGHFLEG
QEIITQNGKKWILQISYNEKLQQIECVFSRQKKEDTSKQQFYYLFKFYALSQTESIIDKS
YNGNKTFSIESLSQSFNFPLDIELILEKYQHIIFELTLTPNRLQFYNSKEETNYVGLLNE
GQTCYMNSYLQTLFHIKAFVKLVYSIPTDKESEPVFPNSLQVLFYQLQSRGSYCTTTELL
KSFQWDKSKARIQQDVQEFSCLFIEYLESKAEKIPQLKGQIKHLFQGKIQNYIKCINVEY
ESVREESFFEISLNLKGCKNIYESLDDYVKEELLEKDNKYDTGDARYQKQDAKKGIKILE
LPPVLFFHLKRFQFDYQTGRNIKIVDQHQYYEEIDMTKYIANPTKDECYKYQLFAVLVHS
GDFSSSGHYYAYIRPDPKQNNWFKFNDSIVEKSSKKQALDYSFGGKVFFKGFDKTKKQLA
YENMSINSTAYMLVYINKREINNILAEIPIQNVPKWVIDQEDQLIQNYLLKQKLSRITSF
DLLKKQQQTCGIYFQKQTKRDEQPEINESIIYKKEVDKSKTFKEFFEELCSEIGAEPEDL
GLWKIDYLPNSVEKLTNQIKKLVTHGQELIEKVYFENFPNQQNSNTATNLNQYPAPVFVI
IPISTSKFVGNRQIFQQGPDGQIEIKKQDKISSNGEKRMSSQNDWNRYFQFQEGTLMLII
IKSFEYTKEGVKIQFIDYIYYNPLSTFSQLSEEIIKKKRLDMCSFQFYKEESYNVQKLSV
EVNGQTHLKNIFNSTDCGVIIISYESKLSKENNISIISYYQQLEDQVRVRFVFSSNPLSV
NTVSASMNSATSPFQNIQQNANKLNNQQSAVANTFFTDTSNNQNKINTTQIDPHQFLKNF
QLNSLLPNEGIQFDKIFLKTIKYSQLQMSLFNCLKEYLREQIKQYYPYQSDSPNSMESEE
VVKSSNFLTNPKKLTQNVNIQAIEQFINLDDSFHEYILFKCKMRKRNIEEIPFFQSSVSE
TSLQDLFKHFDNTIVLHFDFSKSLRAKDRDQKLVIEYVLYSNSFNKIYANQVIDIDKTAN
MQTLGNLLKQQKFFKEYMQAEQDYAQKQGIIPPSIVKVCQLSRDNPNRIELYYTESTKLN
TIKKNQLIRVELHQEIKESEILYICHQTTKNGVEAFDNPFSFPLSVYWKVKELKNKVVQI
LTDRQIIFDGKKVEVNRDNLQIILYSEYSKYDSASLQVEDTNEKLIKHEIDIDSFKNKCG
YLEIQHINLLSSTDNKAIKFDIN
NT seq 5472 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagattgttaagcataatagcaagctttaataaaaggttaagaaattcaagatc
aatgaagctagtgaagataaggacaccaatgaagaagatgatgatatataaaattttgaa
cacttagatgtataaaagtagaaaaaaattcaaagcagcaaataagcaacttcttcatct
tcttcaaattaccatttagctaattaaaataattcaaagctttatgcataagatatttcg
ttcacaatagacgagtcagaggaagaattagctatccctaattaaccattaaaacatgcg
ttcaagaaaaaaattagaaatagtagttagagcagcagtagcgaacgagatgaatttgct
aatttaaaaagtaattaagatgctgcttaaagaaatgctaagtagaataacggcaaaaaa
gttaataacagtaaaggatttcctgcagtgaattattcaaattagtaagattataaaagc
gccccagatatgaaagacagctctaagtataaaaataaagaaatctcttctaagtaggat
atttaaaagctttcaaaaaattttgaaaatgattaacttatcaataaaccttaaaaaaaa
attaaacgagacactttttcgtcaaaatttgtaaatgaggaaaaaaattaaatagaagga
gaaagaactaataattctgataaaagcatcgagacagcaataaataataaagaaaatctt
aaaaatggatcactaagtaaccaaaattaaaaggttttaactaactttaatcagtaaaat
caaaatctaaatgaaaaaccaagcatcaaagcattgtttttggaagaaaatgaagatatg
tcaacaaataataaataggttaaaaagaaagattaagcattacacatccaagttatagat
ttggaagtgtctgacgatgaaaggaagaatgtttatttgcaaaaaggagaaaagcaacaa
gaattagaataatctgctattgaataaaagataattaaaggttactcttctgtttcttag
aaaaaattaaaataagagaataagctaaatagtagctttgatagctacagtaatgcagat
ggattatctatataggcttaaggatctaattcctctcagatggatatcagatctatcaat
taagttaatttgttagataatggtgataatgatagtattttgtgcaattatagcaatctt
gatgaagattaggattaaaattatagtaatttaattggattaactagcaataacttaaat
aatagttacatggaggatgaagaagatgatttatttgacactattaaaattaaaaaaaag
actaatgcatatgaaataatcaatcaaacaggtgatttaaataagcagattaacacgaat
atgagatttaatcataataattctcataagagtggaatttcatctgatagttcacttcaa
attcactagaagtcaccatcaaaataaccagctagaagtagttttagtcctatataaaat
atgaagaaagattaataaaacaatatgagcagtagtaattttagtcattctgttagtgct
aattagcttaacattacaagtaataaaaaaaaagatgccaaaggttaacaaggattaagt
tcaaaccaaagcaaaattaatatagattattaacaagaagaactttagaatattagtaat
atagaggaagaaatttttgaggtcaacgagcttccaaaagaaaaaactagaattttatgg
atatttaatagcgttcattttattgagaggctaacaaataatggacattttcttgaaggt
taggaaataataacttaaaatggtaaaaaatggatattgtagatttcgtacaatgaaaag
ttatagcagatagagtgtgtttttagcagataaaagaaggaagatacttcaaaacaataa
ttttattatttgtttaaattttatgctttgagccaaacagaaagtatcattgataaaagc
tataacggaaataaaacattttctattgaaagtctttcacaatcatttaatttcccttta
gatattgaattaattcttgaaaaatactaacatatcatttttgagttgactcttacacca
aatagattgtaattttataattccaaggaagaaactaactatgttggacttttaaatgaa
ggtcaaacttgctatatgaattcttatctttaaacgctatttcatatcaaagcatttgta
aaattagtgtactctattccaactgataaagaatcagagcctgtttttcctaattctttg
taggtcctcttctattagctccaaagtagagggagttattgtacaactacagagttgctt
aaaagtttttaatgggataaatctaaagcaagaatacagtaagatgtccaagaattctct
tgcctttttatagaatatttagaaagcaaggcagaaaaaattccataactcaaaggttaa
ataaaacaccttttctaaggtaagatttaaaattacataaagtgcattaacgttgaatat
gaaagtgttagagaggaatccttttttgagatcagcttaaatttgaaaggatgcaaaaac
atatacgaatcgctagatgattatgtaaaagaagagttactagaaaaggataacaagtat
gatactggtgatgcaagatattaaaaataagatgcgaaaaagggaataaaaatattggaa
ttgccaccagttttatttttccacttgaagagattctaatttgattactaaacaggaaga
aatataaaaatagttgattaacatcaatattacgaggaaatagacatgacaaaatatatt
gcaaatcccacaaaagacgagtgctacaaatattaattattcgctgtgttggtccacagt
ggagatttttcttcttcaggacattattatgcctacatacgtcctgatcctaaacaaaat
aactggttcaaattcaatgattctattgtggaaaaatcttctaaaaagcaggcacttgat
tactcttttggaggaaaagtattttttaaaggctttgataaaaccaaaaaataattggca
tatgaaaatatgtcaataaactcaactgcttacatgttagtgtatataaacaaaagagaa
attaataatatcttagctgaaattccaatataaaatgtaccaaagtgggtaatcgaccaa
gaagattaactcatttaaaattatcttcttaaataaaagttatcaaggataacctcgttt
gatttactaaagaaatagcaacagacttgtggaatttacttttaaaaataaaccaaaaga
gatgaataaccagaaataaacgagagcataatttataagaaagaagtggataaaagcaaa
acatttaaggagttttttgaggagttatgctctgaaatcggagcggaacctgaagattta
ggtttatggaaaattgattaccttcccaatagcgtggaaaaattaacaaactaaatcaaa
aaactagtgacacatggataggagttaatagaaaaagtatattttgaaaacttccccaac
taataaaattctaatacagctacaaacttaaattaatacccagctcctgtatttgtaatc
atacccattagcacaagcaaatttgtgggtaacagataaatattctaacaagggccagat
ggctagattgaaataaaaaagcaagataaaatttcatcaaatggtgagaagcgaatgagc
tcttaaaatgactggaacaggtatttctaattttaagaaggaaccctaatgctaattatt
attaagagtttcgaatacacaaaagagggagttaaaatataatttatagattatatttat
tacaatccacttagtacattttcttagctctctgaagaaataatcaaaaagaagagactt
gatatgtgttcattttaattctacaaagaagaaagttataatgtccaaaagttaagtgta
gaagtaaatggccaaacccacttaaagaatatatttaattctacagattgtggagtcatc
atcatttcttacgagtctaaattatccaaagaaaacaatatttccattataagctactat
taatagttagaagatcaagtaagagtaagatttgtgttttcttccaaccctctctctgta
aatacagtctcagcgagtatgaattctgccacatctcccttttaaaatatataataaaat
gcaaataaattaaacaattaataaagtgcagttgctaataccttttttactgatacatca
aacaatcaaaataagataaatacaacataaatagatcctcatcaattccttaaaaacttt
taacttaatagccttttaccaaatgaaggcatctaatttgataaaatattcttaaaaaca
ataaaatactcataattgtagatgagcttatttaattgtctcaaagaatatttaagagag
taaatcaaataatattatccatatcaatcagattctccaaactccatggagagtgaagaa
gttgtaaaaagttctaactttttaacgaaccctaaaaagcttactcaaaatgtcaacatt
taggccatagagcaatttataaatcttgatgattccttccatgaatatatattatttaag
tgcaagatgagaaagagaaatatagaagaaatcccttttttccaaagctctgtgagcgaa
acatctcttcaagatttatttaagcattttgacaatacaatagttctgcattttgatttt
tccaaatccttaagggccaaagacagagattagaaattagtaattgagtatgttctgtat
tccaactcctttaataaaatatatgccaactaagtcattgacatagataaaactgccaac
atgcagacacttggaaatttacttaaataataaaaatttttcaaagaatatatgtaagca
gaataagattatgcacaaaaacaaggtataataccaccttcaattgtaaaggtatgttag
ctctcaagagataatccaaataggattgagctgtattatacagaatctacaaagcttaat
accataaaaaagaattagttaataagagtagaattgcattaagaaattaaagaatctgaa
atcctatatatttgccattaaactactaaaaatggagtagaagcatttgataatccattc
tctttcccattatctgtatattggaaggttaaagaattaaaaaataaagttgtttaaatt
ttaacagaccgttaaataatatttgatggtaaaaaggtagaggtcaacagagataatcta
taaataattctatactctgaatattcaaaatacgacagtgcttcattgcaagtggaagac
actaatgagaaattaataaagcatgaaatagatatagactcatttaaaaataaatgtggg
tatttagaaatacaacacataaatttattgtcttcgacagataacaaagcaatcaaattt
gacataaattga

DBGET integrated database retrieval system