KEGG   Tetrahymena thermophila: TTHERM_00321550Help
Entry
TTHERM_00321550   CDS       T01020                                 

Definition
Glycosyl hydrolases family 35 protein (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
tet  Tetrahymena thermophila
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tet00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 631 aa AA seqDB search
MKKELLITLGITALSAIAIVTGYLVYEQKKVVVINNPPFPTTFPQNFSLKKGEFLLNDQP
LYIAAGEIHFSRVPHQYWRDRVKMIKALGLNTLSVYIMWNYHEIQPGVFDFESDDKNLRN
FLQIAKEEQMYVLIRPGPYVCAEWDFGGHPYWLLKDESIELRSTDPKYLEAITLYLNRVA
QEIEDYQITNNGTIILLQVENEYGYYGKNNKYPIKLQEMWESTGKIKVPYYTVDKWIFSK
VGHVKGAAFGLNPGTLDIGYWYTHLLEKDMPVMSSETYPGWLTHWGQNYQGKSTKDTVKM
FESIVRKRHSFSIYMVFGGSNFGLNAGANNNPFNTLFQPDITSYDYDAPINEQGAATEKY
YALREMFQTYFKWDFPPVPQITPVMQISPFTVQRVSSLWQLIEKTPKQIFDSPKRFEFFD
QNQGIIAYTFEVPLVKGKNELKFEQISDYARIYLTDSKEYLGTIDRIHNQKSIVFSQFYN
SRANITVIVEAFGHVNFGKHMYDPKGIFTNITINKQQVQSSFSHQLIPLQDIPNFTDSIS
GKDVNVEGFFQANFNLDQNTTIIGDTYLDMSSWGKGYVWVNGFNLGRFWSEGPQQRLFCP
STILQKENNHIVILDLLQNNSSQVSGQLSLK
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagagctcttgattactcttggaataactgcgctatcagctattgctatagta
actggttatttagtctacgaataaaaaaaagtagtagttattaacaatccaccttttcct
actactttccctcaaaatttcagcttaaaaaagggagagtttttgttaaatgatcaacca
ctctacatcgcagctggtgaaattcatttctctagagttcctcatcaatattggagagat
agagtaaaaatgattaaggctttaggtctcaacactttaagtgtttacattatgtggaac
taccatgaaatataacctggtgtttttgattttgaaagtgatgataaaaatttaagaaat
ttcctttaaattgctaaagaagaataaatgtatgttctcattagaccaggtccatacgtt
tgtgctgaatgggattttggaggtcacccatactggctccttaaggatgaaagcattgaa
ttacgttcaacagatcctaagtatttagaggctatcactctttatttgaatagagttgct
taagaaatagaagattatcaaataactaacaacggcacaataattcttttataagttgaa
aatgaatatggatactatggaaagaacaataaatatcctattaagctgtaagaaatgtgg
gaaagcactggtaaaatcaaagttccctactatactgttgataaatggatattcagtaaa
gttggacatgttaaaggtgctgcttttggtttaaatccaggtacacttgatataggttat
tggtatacacatctcctagaaaaagatatgcccgtcatgagctctgaaacttatcctgga
tggctaactcattgggggtaaaattactagggaaaaagcactaaggacacagttaaaatg
tttgaaagcattgtaagaaaaagacactcgttctctatttatatggtctttggtggctct
aattttggattaaatgcaggagccaataataatccatttaacactctattctaacctgat
atcactagctatgattacgatgctcctattaatgagtaaggtgctgccactgaaaaatac
tatgctttaagggaaatgttttagacatacttcaaatgggatttccctcctgttccttaa
attactcctgtcatgtaaatatctccttttacagtataaagagtttcttctttatggtag
ttaattgaaaaaactcctaaatagatatttgattcccctaaaagatttgaattctttgac
taaaactaaggtattattgcatatacctttgaagttcctctagtaaaaggtaaaaatgaa
ttgaaatttgaataaatcagtgattatgcaagaatttatttaaccgactcaaaggaatat
ctaggaactattgatagaatacataaccaaaaaagtattgttttcagctaattctataac
tcacgtgcaaatatcactgttattgttgaagcttttggtcatgttaattttggaaaacac
atgtatgatcctaaaggtatttttacaaacataactatcaacaaataataagtttaatct
tcattttctcatcaactcattcctcttcaagatattcctaatttcactgattcaatatca
ggtaaagatgttaatgtagaaggcttcttctaagcaaatttcaatttagattaaaatact
acaataattggagatacttatttggatatgagttcatggggtaaaggttatgtttgggtt
aatggatttaacttaggaagattctggagtgaaggtccataacaaagattattctgccca
tctactatactctaaaaggaaaacaaccatattgttattttagacttgcttcaaaataac
tcatctcaagtttctgggtagcttagtttgaaatga

DBGET integrated database retrieval system