KEGG   Tetrahymena thermophila: TTHERM_00321600Help
Entry
TTHERM_00321600   CDS       T01020                                 

Definition
Glycosyl hydrolases family 35 protein (EC:3.2.1.23)
Organism
tet  Tetrahymena thermophila
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 634 aa AA seqDB search
MNKVALIASFLAGLSILSISFVYLNQKDLKAEVIITNPPFNTTFPQTFELKDQQFVLNGQ
PLYVAAGEIHYSRVPSQYWRTRIQTIKALGLNTLSVYIMWNHHEVAPGVFDFSSPDRNLR
NFLQIALEEQMYVLIRPGPYVCAEWDFGGQPFWLLKENVELRSTDPKYIQAITPYINRVA
QEIQDYQITRNGTVLMVQIENEFGSYGSNNTYPLKLKQIWDDTKKIQVPYYTADGGSLIK
TGHVPGAAFGLNPGTNEKDYLYAHSLEFNMPVMSSETYPGWLTHWAENWAGRDISSTVSE
FENLVKNKHSFSMYMVFGGSNFGLTAGSNNDNSDTAFQPDITSYDYDAPINEQGAPTDKF
YALREMFKSHFNWTIPNVPQIQNLTTVDQFTPQRLGSLRLLYNSLPKVTFQQAQSFEVLN
QNQGIVVYTFQVPISNSPQNTNYTLSFDKIRDFAKVYVQVNNSTTYNGTINRMNQQNSFS
FSYSGNATNATVTIFVEAFGHVNYGHTSFDNKGIIGNIYFQNKNISNISHTLIPLQNIPN
IIPSPSAVDSQNSETFFKGTFKINGQIGDTYLNMSNYTKGYVWVNGFNLGRYWNIGPQQK
LFCPATILKQNNEIVILDLIQNTAAPIKGELTLH
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgaataaggtagctttaattgcatcatttttagctgggctttctattctttctatcagc
tttgtttacctcaatcaaaaggatttaaaagctgaggtaatcattactaaccctccattt
aataccacattcccttaaactttcgagcttaaagactaataatttgttttgaatggatag
cctctttatgtagctgctggtgaaatccattattctagagtaccttcccaatattggcgt
acaagaattcaaactataaaagctcttggtttaaatactttaagtgtttacataatgtgg
aatcatcacgaagttgctcccggtgttttcgatttctcaagccctgacagaaacttaaga
aacttcttacaaattgctttggaagaataaatgtatgttttaataagacctggtccctat
gtatgcgctgaatgggatttcggtggctaacctttctggcttttaaaagaaaatgttgaa
ttgagatcaactgatcctaagtatatttaggctattactccttatatcaatagagttgct
taggaaatctaagattaccaaattacaagaaatggtactgttcttatggtttaaattgaa
aacgaatttggctcttatggaagtaataacacttatcctctcaaattgaaacaaatttgg
gatgatactaaaaagatttaggttccttactacactgctgatggtggcagtttgattaaa
actggtcatgttcccggtgctgcttttggattaaaccctggcacaaatgaaaaagattat
ttatatgctcattccctagaattcaatatgcctgttatgagttctgaaacttatcctgga
tggttaactcactgggctgagaactgggctggacgtgacatttctagcactgtcagtgaa
tttgaaaatttagtcaagaacaaacactctttctctatgtacatggtatttggtggctct
aactttggtttaactgctggttctaacaatgataattctgatactgccttctagcctgat
attactagctatgactacgacgctcctattaatgagtaaggtgctcccacagataagttc
tatgctttgagagagatgtttaagtctcatttcaactggactatccctaatgttccccaa
atacaaaacttaactaccgttgactagtttaccccataaagattaggttctcttagactc
ctttacaactctttacctaaagttactttctaataagcttaaagtttcgaagttttaaat
caaaactaaggtattgttgtttatactttctaagttcccatcagcaactctccttaaaat
actaattacactctttcttttgataagattagagactttgctaaagtttatgtctaagtt
aataactctaccacttataacggcacaattaacagaatgaattaatagaattccttcagt
tttagttattcaggtaatgccactaacgccactgtaaccattttcgttgaggctttcggt
cacgtaaactatggccacaccagtttcgataacaagggtatcattggaaatatttacttc
caaaacaagaatatctctaacatttcccacactttaattcctcttcaaaatattcctaat
attattccttctcctagtgctgttgattctcaaaacagtgaaaccttctttaaaggtact
ttcaagatcaacggttaaattggagacacctatttgaatatgtcaaattacactaaaggg
tatgtctgggttaatggattcaatttgggtagatactggaatatcggtcctcaataaaag
ctattttgtcctgctaccatccttaaatagaacaacgaaattgttattcttgatttaata
taaaacactgcagcacccatcaagggagaattaacacttcattga

DBGET integrated database retrieval system