KEGG   Tetrahymena thermophila: TTHERM_00324420Help
Entry
TTHERM_00324420   CDS       T01020                                 

Definition
Ubiquitin carboxyl-terminal hydrolase family protein (EC:3.1.2.15)
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
tet  Tetrahymena thermophila
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:tet04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 528 aa AA seqDB search
MSKRITRSAHVDLLENIKADLPSKQLKKQDEKKQTNSKTRQKDENVIQDDQDQTQSLSEQ
NIDQKNKAKKGKETKEEKEKRIKQEQEEKRKKEEEEEKRKEEEEKSFIDDFKRKNNLINT
KDHKERIETYQNKLYSDKKKQKKGNVQDEQEEEEVIDLAENKVKGKVGLINLGNTCFMNS
ALQCLSNLQPLTDYCLQNKEDNEINIQNPMGSGGVVIKAFANLVRQIWNQKEDSVSPDEF
LRVISYFNKIYSSGRQQDSQEFLLYLLDQIHEDLNRVEKKPYVEQKEYFKNLNQKELEKL
AADSWGDYLKRNKSVIVDLFQGQLKNTLKCLKCKTAKYQFEPFMYLTVPIPQKAENEINI
QDCIEQFTEKEILDGDEKWFCPECKDFQKSEKKIDLWKLPPILMICMKRFQYTAQSKKKI
TTKVQFPVQHFDMSEFIPKTLQKEKPIYDLFSVISHKGYLNFGHYVAYCKNQEDKQWYLF
NDSKTSLIQDPEENIPKKEAYVLFYQKSTLQLIKRQTLVESVNWPHKV
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaaggattacaagatctgctcacgtagatttactagagaatattaaagctgat
ttaccttcaaagtagctgaagaaataagatgaaaagaaataaactaatagtaaaactaga
taaaaagatgagaatgtcatttaagatgattaggattaaacttaatctttgagtgaacaa
aatatagattaaaaaaataaagctaaaaagggtaaagagacaaaagaagaaaaagagaaa
agaataaaataagaataggaagagaaaaggaaaaaagaagaagaggaagaaaaaaggaaa
gaggaggaggagaagagttttatcgatgattttaaaagaaaaaataacctaatcaataca
aaagatcataaagaaagaattgaaacatattagaataaactttattcagataaaaaaaag
caaaagaagggcaatgtataagatgaacaagaagaagaagaagttattgatcttgcagaa
aataaagtcaaaggaaaagttggattgataaatttaggaaacacttgctttatgaattct
gcactttaatgtttaagcaacttataaccattgaccgattattgtttgcagaataaggaa
gataatgaaattaatatttaaaatcctatgggttctggaggtgttgtaataaaagcattt
gcaaatcttgtgagacaaatatggaattaaaaagaagattcagtcagtcctgatgaattc
ttaagagttatttcttatttcaataaaatatattcttcaggtagataacaagactcttag
gagtttttactttatttgctcgatcaaattcatgaggatttaaacagagttgaaaagaaa
ccatatgttgaacaaaaagaatattttaaaaacttaaatcagaaagaattagaaaagtta
gcagctgattcttggggagattatttaaaaagaaataagagtgtcatagtagatttattt
taaggataactcaaaaatacactaaaatgcttaaaatgtaaaacagctaagtattaattt
gaaccttttatgtatctgacagtacccattccttaaaaagctgaaaatgaaataaacatt
taagattgtattgaataattcacagaaaaagaaatactggatggagatgaaaaatggttc
tgccctgaatgtaaagatttctaaaagtctgaaaagaaaatagatttgtggaaattacct
cctattttaatgatctgtatgaagagattttaatatactgcttaatcaaagaaaaaaata
actactaaagtttaattccctgttcaacattttgatatgagcgaatttattccaaagact
ttataaaaagaaaaacccatatatgatttattttcagtaatatctcataaaggttattta
aattttgggcattacgttgcctactgtaaaaactaagaggataagcaatggtatttattt
aatgatagcaaaacttcattaatataagatcctgaagaaaatattcctaagaaagaagca
tatgttcttttttattaaaaatcaactctccaacttattaaaagataaacattagttgaa
agtgtaaattggcctcataaagtttga

DBGET integrated database retrieval system