KEGG   Tetrahymena thermophila: TTHERM_00343420Help
Entry
TTHERM_00343420   CDS       T01020                                 

Definition
Protein kinase domain containing protein
Orthology
K08850  
aurora kinase, other [EC:2.7.11.1]
Organism
tet  Tetrahymena thermophila
Brite
Enzymes [BR:tet01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     TTHERM_00343420
Protein kinases [BR:tet01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   TTHERM_00343420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 360 aa AA seqDB search
MKTFDFNYNQSALQNQQKLKNGTSSQILKNIKDQENKNSSKDQENFKNSQLLSVKSIKKI
EQIEQQSDRVQILKVPKIQWQLSDFELGKPLGRGKFGQVHLAREKRSNFIVALKCISKEQ
LRRSKIEHQIRREIEIQSHLNHKNVLRMFGFFWDEQKIYLILEYAPQGELYQDLQKQINK
RYPEQKAANYIKQMAEALIYLHSKDIIHRDIKPENLLNSFGTIKIADFGWSIHSPSNKRQ
TICGTLDYLSPEMVEGNTHNYTVDIWSLGVLCYEFCTGQPPFETKSYDQTYDRIKKVQFS
FPDYLSIEVRDLLSKILVYEKSQRLDLNNILNHPWIQKHNPPQNQVTSQVPLQQLNQNIC
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaagacctttgattttaattacaactaatcagcactatagaattaataaaaacttaaa
aatggaacatcttctcaaattttaaaaaatataaaggattaggagaataaaaatagctca
aaagattaagaaaacttcaaaaattctcagcttttgagtgttaaatccatcaagaaaatc
gaataaattgaatagtaaagtgatagagtataaattctgaaagtcccaaaaatttagtgg
cagcttagcgattttgagctaggaaaaccattaggaagaggaaagttcggccaggtgcat
ttggctagagaaaaaagaagcaattttattgtcgctctaaaatgtataagtaaagagtag
ttgagaaggagcaagatagagcattaaataagaagggaaatcgagatataatcgcattta
aaccataaaaatgtgcttagaatgtttggatttttttgggatgaataaaagatttattta
attttagaatatgctcctcaaggagagttgtattaagacctataaaagcaaataaacaag
agataccctgaataaaaggcagctaattacatcaaataaatggcagaggctttgatttat
ttacatagcaaagacattattcatagagacataaaaccagaaaatctattgaattcattt
ggaacaattaaaatagcagatttcggatggtcaattcattcaccttcaaacaaaagacaa
actatctgtggtaccctcgactacctatcccctgaaatggtagaaggaaacactcataat
tacactgttgatatttggagtcttggtgttttgtgctatgaattttgcactggataacct
ccatttgaaaccaaaagctatgattaaacatatgatagaattaaaaaagtacaatttagt
ttccctgattatttgtctattgaagtcagagatcttttatcaaaaattttagtttatgaa
aagagctagagattagatttaaataacatcttaaatcacccatggatctaaaaacacaat
cctccttaaaattaagtaacaagtcaagtaccactttaacagctaaactaaaatatttgt
tga

DBGET integrated database retrieval system