KEGG   Tetrahymena thermophila: TTHERM_00348940Help
Entry
TTHERM_00348940   CDS       T01020                                 

Definition
(RefSeq) Serine/Threonine kinase domain protein
  KO
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
tet  Tetrahymena thermophila
Brite
Enzymes [BR:tet01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     TTHERM_00348940
Protein kinases [BR:tet01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   TTHERM_00348940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 1363 aa AA seqDB search
MNAYKPKFHKKLMISPKNASYDLNFRGFSQGSAVITPQAEKVQSTRNSFAIDQKNKDSIL
QSNISQPESTKQNHFGYQNQLAHQQIQQQQLQQQQQSLQQMQQQQQQMTLQQSQNQLNQQ
HQQQLIMMIQQQQQQQHGQQLPNQTSSKKSNQQQQMQQNQIQQSQYSNVLNLLMQQQPTQ
PPQQHQQIYQNLNNSQQYTTMQQSSGQNYSNQSFTTNRQNSNANYLYHQLNPPQSTKAAD
SNRRQNNPFSGTYSTKNTSAPQQLLKDILSKINKEQVQQQLPYQQNQQVLRSSHMMNNSQ
NNSNSNVVILNNNTQNANNQNIYSSNYVNTNPDLSNIYNPNNLAAMNPQPSSTKSNRIHS
HYFPATTKNKSNRNPSLDKLNDSSFLRLKNVQSPKQRTIRTIMPGSNRDNSVGNNSSINR
NGYFQREYSESGVDASNQYILPASLLQQKTKRSGNSITGGVNNVIANNNNSYNNGSYSKI
QPHLPQNQTRQNGTPYVKKDLTIKTGNSIETLKDILSPTNNNANPKTTTATKDSKKHLNS
NTLPIQSYTTTHAQQIHQQKRLLQKRDDQKNKSNFINSSFQYIMASENNSVENTNRFSYN
VMNNMVANNQGQKLLKNKNNSMENQQFKNLSFTQPLNDQFKQTKENNNTQNSNNKILTVK
QQQQKQQLQFIQKGLGQNSSKQNQSSIQTSEGNENKSESNYESQGQNLDNFDQHKIDLST
ASQTPFRNGNSTNEKKTLDDNNTRNTERDEKKEEPLDWEKVKVPITPLEVLAKYQKYLTP
QEKAEILEFKRIYFIGHNANKAAQENGNNDDTKGDYQYNVNDHIAYRYEIKEFLGKGSFG
QVLKVFDHKRKEYAALKVIRNKQKFHEQALIELNILHYIKEKDYDNQTNIVKIRDFVIFR
NHVCLVFELLSINLYDLLRNNKFQGLSLELIRRFAIQLLNAISFLKENRIIHCDLKPENV
LLKQPNKSGIKIADFGSSCFDDQVMYTYIQSRYYRSPEVILGIPYGTEIDMWSFGCIIAE
LFLGYPIFPGEDENEQMGYIMELLGAPDSEFLKKCSRKKYFFDQNDQPLQIPNSRGKIRM
PNSKNWKSVIGCTDDNFIDFIKKCLVWEPSQRLTPRDALLHPWILDGLPEDIRVQHIKFL
KDKSFETASEKEFHKQSCLQAQYNADAQSAAMALALQKIYKYNNKKRILEKKSTTQGTVS
EETRNSVMEEKKQTAEVSQMFNNFFIQPESTKNNNKNNQNSFNNNTNNSQNFSNGNPMND
TNKSNSLNQNNFSNNNNNIQNQNNFIILTNPNKIKIPNANSNSLTQKKKITAQILQDQQN
QHSFQANQNSQQTQQKLTLQQQQVQLQLQLQKIAQQQKLQKLQ
NT seq 4092 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcatataagccaaaatttcataaaaagttaatgatttcgcctaaaaatgcgtct
tatgatctcaattttagaggattcagctaaggctcagctgtcatcactccataagcagaa
aaggtttaatctaccagaaattcttttgctattgattaaaaaaataaagactcaattttg
taaagcaatatcagctaacctgaatcaaccaagtagaatcattttggatatcaaaattag
cttgctcactagcaaatacagcaataatagctttaacaacagcaacaatctctatagtaa
atgtagcagtaataatagtagatgacattatagcagtcatagaattaacttaatcaataa
cattaatagcagttaattatgatgatttagcaataatagtagtagcaacatggttagtag
ttgccaaattagacttcttctaagaagagtaattagtagtagtaaatgtagtaaaaccaa
atataatagtcttagtattcgaatgttttgaatcttcttatgcaatagtagcctacataa
cctccataataacattagcaaatttactaaaatttgaacaattcccaacaatataccacc
atgcagtaatcttcaggataaaattattctaactaatcttttaccacaaatcgttaaaac
tcaaacgctaattatttataccattaacttaaccctcctcaatcaacaaaagctgctgat
tcgaataggagacaaaataatcctttcagtggaacatattcaacaaagaatacttctgcg
ccttaatagttattaaaagatattttgtctaaaattaacaaagaataagtataacaacaa
ttaccttatcaataaaattagtaagtacttagatcatctcatatgatgaataacagctag
aataatagcaacagtaatgtagttatattaaacaacaacacgcaaaatgcaaataattaa
aatatttattcttctaactacgtaaataccaatcctgatcttagtaatatatataatcct
aataatcttgctgctatgaacccataaccttcatcaacaaaatctaatcgtattcattca
cattacttccctgcaacaactaagaataaaagcaacagaaatccaagtctcgataaattg
aatgattcttcttttttaagattaaaaaatgtccaatcaccaaaacaaagaacaattaga
acaataatgcctggtagtaatagagataattctgttgggaataattcttcaataaataga
aacggatatttctaacgcgaatatagtgaaagtggtgtagatgctagtaattaatatatt
ctcccagcaagtttattgcaataaaaaacaaagagaagtggcaacagtattactggagga
gtaaataatgttattgcaaataataataacagctataacaatggatcatatagcaaaata
taacctcacttaccttaaaactaaacaagataaaatggcacgccatatgtaaagaaagat
ttaacaataaaaacaggtaactcaatagagactctaaaagatattttatcacctacaaat
aacaatgcaaaccctaaaactacaactgctactaaagactctaagaagcacttgaatagc
aatactctacctatacaaagttacactactacacatgcgcaataaatacatcaataaaaa
agattgctccaaaagcgagatgatcaaaaaaataaatcaaattttataaattcttctttc
taatatattatggctagtgaaaacaatagcgtggaaaacacaaatcgtttttcctataac
gtgatgaataatatggtagctaataattaaggacaaaaattgctaaaaaataaaaataat
tcgatggaaaactagcaattcaagaatttatcattcacataacctctgaatgattagttc
aaataaacaaaagaaaataacaacacacaaaactcaaataataaaattcttacagttaag
tagtaacagtaaaagcaataattgtaatttatacaaaagggactaggttaaaactcaagc
aaataaaattaatcttctatctaaaccagcgaaggaaatgaaaacaaatctgaatctaac
tatgaaagctaaggataaaatttagataactttgatcaacataagatagatttgtcaaca
gcaagctagactccttttagaaatggcaattctacaaatgagaaaaaaactttagatgat
aataacacaaggaatacagagagagatgaaaaaaaagaagaacctttagattgggaaaaa
gtgaaagtaccaataactcctttagaagtattagctaagtactaaaagtatttaacacct
taggaaaaagcagaaatattagagttcaaaagaatatattttattggccataatgcaaac
aaagctgcttaagaaaatggtaataatgatgatactaaaggagattattagtataatgtt
aatgatcacatcgcttacagatatgagattaaagagtttttaggtaagggatcctttgga
taagttctaaaagtttttgaccataagagaaaggagtatgcagctcttaaagttattaga
aacaaataaaagttccatgaataggccttaattgagttgaatattttacactacatcaaa
gaaaaagattatgataactaaacaaacatcgttaaaattagagattttgttatttttaga
aatcatgtgtgtttggtgtttgagttgttaagtattaacttgtatgatttactcagaaat
aataaattctagggtttatctttggagcttattagaagatttgcaattcaattattaaat
gcaatatcttttttgaaagaaaataggatcattcactgtgatttgaaacctgaaaatgtc
ctattaaaacaaccaaataaaagtggtattaaaatagctgattttggttcaagctgtttc
gatgactaagtcatgtatacttatatataatcaagatattatcgttctccagaagtcatt
ctcggaataccttatggtactgaaatagatatgtggagttttggatgcattatagctgaa
ctatttttgggatacccaattttcccaggagaagatgaaaatgaataaatgggatatata
atggaattattaggtgctccagattcagaatttttaaaaaaatgctcaagaaagaaatat
ttctttgatcaaaatgattaacctctttaaattcctaacagcagaggtaaaattagaatg
ccaaacagtaaaaattggaaaagtgtaatcggatgcactgatgataactttattgacttc
attaaaaagtgcttagtttgggagccttcttaaagattgactcctcgtgatgctctcctt
cacccttggatattagatggactacctgaagatattcgtgtgcagcacataaaattcttg
aaagataaatcctttgaaacagcttcagaaaaagaattccataaataaagttgcctgtaa
gcataatataacgcggatgcttaaagtgcagcaatggctttggctctacaaaagatttat
aagtacaataataaaaaaagaattttagaaaaaaaatctacaacataaggaactgtctct
gaagaaactagaaactctgtcatggaggaaaaaaaatagactgcagaagtgagccaaatg
tttaataacttttttattcagcctgaaagcacaaaaaataataataaaaataattagaat
tctttcaacaacaatacaaataattcctaaaattttagtaacggaaaccctatgaacgac
acaaataaatcaaatagtttaaatcaaaataatttttctaacaataacaataatatataa
aattaaaataacttcattattctcaccaacccaaataaaattaaaattccaaatgcaaat
agtaatagtctaacttaaaagaagaaaataacagcttaaatcctacaagatcagcagaac
caacactctttttaagctaattaaaactcataataaactcaacaaaaattgactctataa
taacaacaagtctaattataactgtagctacaaaaaatagcttagtaataaaaattataa
aaactttagtga

DBGET integrated database retrieval system