KEGG   Tetrahymena thermophila: TTHERM_00378550Help
Entry
TTHERM_00378550   CDS       T01020                                 

Definition
(RefSeq) ubiquitin carboxy-terminal hydrolase
  KO
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.4.19.12]
Organism
tet  Tetrahymena thermophila
Brite
Enzymes [BR:tet01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TTHERM_00378550
Peptidases [BR:tet01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TTHERM_00378550
Ubiquitin system [BR:tet04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    TTHERM_00378550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 2896 aa AA seqDB search
MSINNSDQASQQHSEMIIEESNTMAAGAISQNQSEQQRLLNGEAAQTQPAAQPQQQNSQQ
QPSTSNNLNMEQNYNQNSSALNTSEDMQQNENEFREILISDYFQKGFYMDVREHLGDWRV
GIVQQIYEKQQRLFIQFDGSKSDEHVLMSSNKLAHFRKFTKGYTGEKNNASRVKRNIEDI
KLMIQPFKQMIKANYQGVSAFDFTQEFRGKYFFAMDQALQNISYEDESREQVIKLIKNHI
NYTIKYIKEFPNYFTDYYKEYTNQLSYMYDLPVAIAHGSYEMFEMLLSIFGTTDRLVTNQ
NCFYAKNWFFIRENQDQILEQFPEKIIKIHHTNLLENEDNDGMQEEIIGQQQSLIHQQKA
QLRSKIKSEIIPIFTNYFWLNGGFEAMNQLFNDQNKMIPLLSLYQISKIIYYSINNMKDK
YIVIIIDQLCNYIIQRMSLITEREIKEYDPRLVKSIRDYLQNTVKYHPDQDKQDMYLKRI
DEMDLNLALKLLSSQYLNKKIQGLNDISEIIAEIKQNDSFQNGSNNDDIGFRNNSEYYSD
QMNDRRFNPKEFTEWVIKNQIIDHLLGDSMHVEIVRRCHEIIRFMCFCKQFPVELIDTIW
NSCGSDKHEVIVSAIFEMIISITDQLSKEALFKFHEKINSIPLNEINEQTLMLIKGFSQK
AIDILIPSSKFAYFSQDQDGSDTEELEDGQEQQNQEEQKESKSKLSKEAKEQQYEKNFFC
LELLLKLINEDNNQNLSYLVVDNALQIAKELLCLQQGSFIAKKYANLFLEQIISGKSSYQ
AYYLIYALVDSQMPPDILISLQKREIDLPKIIVDDICNYLKQIPEQINKLNPAVLENLKN
APNQNYVFKTTVFKGKYSHENNIHVRFQLLEIILTQNFSDNKRIFQLSPQEFDKLWNQFI
QIPNHPCESQIFLNWILNKTIQRQNQNYLNTIDITNLFTFDLIKHIFVNIFCNPAMMKYQ
NFTPELFNIFFYLFKKINLKLRNIELIANLNKFKVQNEDLAGMKTMWDIFGEAENKQVVN
SCCDQLSEIYINHDKNYDPQFRDHYMRQLTEKCMQFLQQGYIKQSSQLIERSVQLLLLFF
SKIEGQSYKKQYELNQQNQYSQYSIQNQQTYTIIFQKENLSKNIKLNQNIPFGILRKKIS
QEFKIPTTSFRLYCRNYKTFIEPFQDEEIIHASRNVFYVHLIEGADMQNAFHPKNFIIQN
NEYFDLLFNLLSLNFPTDECNNNLWELIMKLPTNDHVKQRIIKIQEPWEEILKGSFHKKL
YCLNIMEELFQHPNGNNLWIQKFYGSGGFKYLYEYFITLDMNIIQNALSKRFIEKLLKIM
CYYDSKAKIDMYQDDPEKGQLVFKQRFQRLIECIHRICEYCILREEKDLENCSQEKLNYS
HQCQHYQRMMNQNQNCNNQAEPKQPDFYTVEYEIVLQCIKLIAQDYNDTMHEFFCHPLME
KIIRKGLAQIDNCIIQINLTHFLNVLYGRCKDKHKILKHLLPTMLHNILPDIVRYSKVNG
ILVQQNNLMIPENTPIEVFRAEQTRSFFELAQQIITYSKDIQQLVSEFDFDQTAINITEM
IINRPILETSQNNKDEILCGLFNLLKVIININPNLRLTLSRNYNLIKQILDFSFDFPQIR
KKSESIFNQNQIAIRGPKIKSSDTRSYSFDLLKQISINVPENVYQIIQYLKPLILSGDWR
TKSQKDWDIVPKKNEKSSTGYVGIKNLGCICYMNALLQQLFMIPSFRQTILKCKDPQFES
TAQEDNILYQLKCMFTSLCYSEKEAYNPKSFCHAFKDYDGNPTNVYEQMDIDEFFNSLMD
KLENQMKGTKHSEAIKKHFGGVFSNEIISKGCQHYSEREEEYLSISLQVKNKKDIKQSLE
ALTQGEMLEGDNSYHCEKCDKKVVALKRTCLKKLPNHLILVLKRFEFNYDNMQKVKINQF
CSFPFEIDFQEFSQQGLRKAEQAQNKQQNHGNHAEYPDNYFKYRLYGIGIHMGIADSGHY
YSYIRDREAQNGENKWMEFNDNVVKFFDPKDIPNEAFGGEEKWKQFYMMENMNMMNQFRQ
KIRNAYLLFYDRIEKFDEDQFQQASASPKEKDLSSEQNVKILEFDDEQEDNISVKEEDKK
QNLKMEAEEDEEIIQERTLSNALNGADAASGEQKSKEQQNQQKIEEEEENSEYEEKYCGE
FKQELLKQNTSFHLHKILFSQEFCIFMNNLIHQYNQTLGENRQPLEYPFDLNSNTITKEF
YDLHFIKFSLTYFFTTAIRQRVVRNENNVNLDQFYSLITQQLYKNIPAIQWLIKCFTDPR
LIKEIIMSPSSDAKEIVIIILEQSCKVLFSLEKAHLHDVEEETDLPKTLLGQFINALIYC
LNIAENYQEYFELIFRLIQIDEEIAQYLLQRMFIGRAMEFIFSSEGKKKKNNQQMGVNQQ
LDFPKTPFRTSDTPMMGLPSQEKQKKQYDSFYKKDRSGFADSTSITYLFRILEYLILRSN
FVTNNPSKIPSKINYNLQKDEIYWLYRDLDSLFYFLNKAKDKLAIKSVNNILAYLSYEDP
VIIDYIYSIAAKIVQEYQSQEFVRSFTLLKKFFSVKDSFQIKKIEVALQKLQQACESNLS
YQRESDVIQQFLIKLCADNHLVASYIYKNQQMHLNNQLKNLHEYNPNKKDADENLQKRDR
YDLQYFDIRIPSRTTQLTCLKNWKIKQLEKLKSGDFNFDVPRFDTDDIMPETEIVKGRYY
DFFDDKEGKWKIIRCYEIHQKKRIAYFFEINIQQMNNYSLNDERELYEKANSFIIIVLHL
STYKLFPFKSMHDHFAIQLQSEEEEENEEAELKKQEDNDDKKTEEENNSTIIQQNNFNEP
NNQNEASNCMMYNEQNHSGSDSDIQNNHAPNSQEREVGEDQESEDEEEEEEEEEEEEELE
EEEEEENEEIHGTSSQ
NT seq 8691 nt NT seq  +upstreamnt  +downstreamnt
atgagtataaataatagtgattaagcgtcgcaatagcattcagaaatgatcatagaggag
tcaaacacaatggctgctggtgccataagtcaaaattaaagtgagtagtaaagattatta
aatggagaggctgcccaaacctaacctgctgcctagccatagcaataaaacagttaatag
tagccatctacttcaaataatctaaatatggaacaaaattacaattaaaattctagtgct
ctaaatacttctgaagacatgcaataaaacgaaaatgagtttagagagattttgatctct
gactatttttaaaaagggttctacatggatgtgagagagcatttgggtgattggagagta
ggaattgtttagtaaatctatgaaaaatagcaacgactctttattcaattcgatgggagc
aaatcagacgaacatgtgttaatgagttcaaataagctcgctcatttcagaaaattcact
aaaggatacacaggagaaaagaataatgcctctagagtcaaaagaaatatagaagatata
aaattgatgatataaccttttaagcaaatgattaaagcaaattattaaggagtatctgca
tttgattttactcaagaattcagaggaaaatatttttttgcaatggattaagctttgtaa
aatatttcttatgaagatgaatcgcgtgaataagtgataaaattgattaaaaaccatatt
aattatacgataaaatacattaaggaatttccaaactattttacagattattataaagaa
tataccaattagttatcatacatgtacgatctacctgtcgcaatagctcatggttcatat
gaaatgtttgaaatgctgctctctatatttggtacaacagatcgtttagttactaattag
aattgcttttacgcaaaaaattggtttttcatcagagaaaattaggatcaaattttagag
caatttcctgagaaaattataaaaatacatcacactaatttgctggaaaatgaagataat
gatggaatgtaggaagaaattattgggtaacagtaaagtcttattcattaacaaaaagct
taattaagaagtaagataaaaagtgaaataattccaatttttactaattacttttggctg
aatggaggctttgaagctatgaattagctgttcaatgaccaaaataagatgataccttta
ctatcactttactagattagcaaaattatttactacagtataaataacatgaaagataaa
tatatagttataattatagactagctttgtaattatattatttaaagaatgagtctcatt
acagaaagggaaatcaaagaatatgatccacgtcttgttaaaagtattagagattattta
tagaatactgtaaaataccaccctgactaagataaacaagatatgtatttaaagagaata
gatgaaatggatttaaaccttgctcttaaattgttatcaagctagtatttaaacaaaaaa
atttaaggattaaatgatataagcgaaattatagctgaaattaagtaaaatgatagcttt
tagaatggcagtaacaacgatgatattggatttagaaataatagcgaatactacagtgac
caaatgaatgacagaagatttaaccctaaagaattcactgaatgggttatcaagaatcaa
attatcgatcatctgttaggagattcgatgcatgttgagattgttagaagatgtcacgaa
attattcgttttatgtgcttttgcaagcagttcccagttgagttgattgatactatttgg
aattcctgtggttctgataaacatgaagttattgtttctgctatttttgaaatgattatt
tcaatcactgattagctctctaaagaagctttatttaaatttcacgaaaagattaattct
atccctctcaacgaaattaatgagcagacactcatgctaattaaaggattttcttaaaaa
gctattgatatactcatcccttcttctaaatttgcatatttctctcaagatcaagatggc
tcagacactgaagagctagaagatgggcaagaataataaaattaagaagaacaaaaagaa
agtaaaagtaaattatctaaagaggctaaagaataacaatatgaaaaaaactttttctgt
ttggaacttttgctaaaattaataaatgaagataataattaaaatttgagctatttggtg
gttgataatgctttataaatagctaaggagcttctttgtctgtagcagggaagctttatt
gctaaaaaatatgcaaatttgtttttagaataaataatttctggaaaatcatcctactaa
gcttattacttaatatatgcattggttgatagtcagatgcctcctgatatcttgatttcc
ttgcaaaaaagagaaatagatttaccaaaaattatagtagacgacatttgtaattatcta
aagcagattccagaatagataaataaactcaatcctgctgttttagagaatttaaagaat
gctccaaaccaaaattatgtcttcaagacaactgtttttaaaggaaaatattctcatgaa
aataatattcatgtaagattctagctacttgagattattttaactcaaaacttcagtgat
aacaagcgtatattccagttaagtcctcaggaatttgataagctctggaaccaatttatc
taaattccgaatcacccatgcgagtcttaaatcttcttgaattggatacttaacaaaaca
attcagagataaaattaaaactatttgaatacgatagacataactaatttgttcacattt
gacttaataaaacacatttttgttaatatattctgtaatccagctatgatgaagtactaa
aacttcacaccagagctctttaacatattcttttacttgtttaaaaaaatcaatctaaaa
cttcgtaacatcgaactcattgcgaatcttaacaaatttaaggtataaaatgaagatctt
gctggtatgaaaacgatgtgggatatctttggagaggcagaaaataagtaggttgttaat
tcttgctgtgattagttaagtgaaatttatataaatcatgataaaaattatgatccttag
tttagagatcattatatgagatagctaactgagaaatgcatgcaatttttatagtaggga
tatattaaatagtcatctcaactgatagagaggtcagtttaattgctgttgctgttcttt
tctaagatagaaggacaaagttataaaaaatagtatgaattaaatcaataaaactaatat
tctcaatactctatttaaaatcaataaacttacacaatcattttctaaaaagaaaatttg
agtaaaaatattaagttgaattaaaatattccatttggaattctcagaaaaaaaatatca
caagaatttaaaattccaactaccagctttaggctctattgcaggaactacaaaacattc
atagaaccattctaggatgaagagatcattcatgcttcaagaaatgttttttatgtccat
cttatagaaggagctgatatgcaaaatgcgttccaccctaaaaattttatcatttaaaat
aatgaatatttcgacttgctttttaatctcttatcattgaattttccaacagacgaatgt
aataataatctctgggagctaattatgaaactaccaacaaatgatcatgttaagcaaaga
atcataaaaattcaagagccttgggaagaaattttaaagggatctttccacaagaagctt
tactgccttaatattatggaggaattattctagcatcccaatggaaataatttatggatt
caaaagttttatggtagtggaggttttaaatatctttatgagtactttatcacacttgat
atgaatattatttaaaatgcactctctaaaagatttatcgagaaactacttaaaataatg
tgctattatgattctaaggcaaaaatagacatgtatcaagatgatccagaaaagggttaa
cttgtttttaaacaacgtttttagagacttatagaatgcattcatcgcatttgcgagtat
tgcattctgagggaggagaaagacttagaaaattgcagttaagaaaagctgaattatagt
cattagtgttagcattatcagagaatgatgaatcaaaattaaaactgtaataattaagca
gaaccaaaacaacctgatttctatactgttgaatatgaaattgtcttacaatgcattaag
ttaatagcataagattataatgatactatgcatgagtttttttgccatcccttgatggag
aagataataaggaagggtttagcttaaattgataattgtattatacaaataaatcttaca
cattttctaaatgttttgtatggaagatgcaaagataagcataaaattttaaagcacctt
ttacccactatgcttcataatatcctaccagacatagttagatattctaaggtaaatggt
atattggtataatagaataatctgatgataccagagaatactcctatagaagtgtttaga
gcagaataaacaagatcctttttcgaattagctcaacaaataattacttactctaaagat
atacaacaattagtttccgaatttgacttcgattagactgcaattaatataactgaaatg
ataattaatagaccgatacttgagacatcataaaataacaaagatgaaattctctgcgga
ttatttaatcttctaaaagtaattataaatattaatccaaatttaagactgactctctct
aggaactataatttaattaaacaaattctagattttagtttcgatttccctcagataaga
aaaaaatctgaaagcatttttaatcaaaattaaatagctattcgtggacctaaaataaaa
tcatctgatacaaggagttattcttttgatttgctcaagcaaatttcaattaatgttcct
gaaaatgtttattaaattattcaataccttaaacctcttatactaagtggagactggagg
acaaagagttaaaaggattgggatattgtaccaaagaaaaatgagaaatcttcaacaggc
tatgtcggaatcaagaaccttggttgcatctgttatatgaatgcactactttagtagcta
tttatgattccctcttttaggtaaactattctgaaatgcaaggacccatagttcgagtct
acagcacaagaagataatattctttattagttaaagtgcatgtttacttctctttgctac
agtgagaaagaagcatacaatcctaaatctttctgtcatgcctttaaggattatgatgga
aatcctactaatgtgtatgagtagatggacattgatgaattctttaactctttgatggat
aaattagagaattaaatgaaaggaacaaagcattctgaggcaattaaaaaacatttcgga
ggtgtcttttctaatgaaattatttccaaaggctgctagcattactcagaaagagaagag
gaatacttgtccatatcacttcaagtaaaaaataaaaaagacatcaaatagagcttagaa
gccctcacacaaggtgaaatgttagaaggagacaactcttaccattgtgaaaaatgtgat
aaaaaagttgtagctcttaaaagaacctgcctgaaaaaattacctaatcatctgatttta
gttctaaaaagatttgagttcaattatgacaacatgtaaaaagttaaaatcaatcaattc
tgctcattcccatttgaaattgatttctaagaattctcctagcaaggcttgagaaaagca
gaataagctcaaaataaacaataaaatcatggaaaccatgctgaatacccagataactat
tttaagtatagactttatggtataggaatacatatgggtatagcagattctggtcattat
tattcttatatcagagacagagaagcttaaaatggagaaaataagtggatggaattcaat
gataatgtagtcaagttttttgaccccaaagatatcccaaatgaagcttttggaggtgaa
gaaaagtggaaataattctacatgatggagaacatgaacatgatgaatcaattcaggtaa
aagataagaaatgcatatcttttgttctatgacagaatagaaaaatttgatgaagattag
ttctaataagcatctgctagtccaaaagaaaaagacttgagttctgagtagaatgttaaa
attttagagttcgacgacgagcaagaagataatatatctgttaaagaggaagataaaaaa
tagaatttaaaaatggaagcagaagaggacgaggaaataatttaagaaagaacgttaagt
aatgcgttgaatggagcagatgctgcatcaggagaacaaaaaagtaaggaataatagaat
tagtagaaaatagaggaggaagaagaaaattctgaatatgaagaaaagtattgtggagaa
tttaaacaagagcttttgaaataaaatacaagcttccatttgcataaaattttgtttagc
taggaattttgcatttttatgaataatctaatacattaatacaatcaaactttgggagaa
aacaggcagccacttgaatatcccttcgatttaaattctaataccatcacaaaagaattt
tacgacttgcacttcatcaaatttagtttgacttatttctttacaactgcaatcagataa
agagtagtcagaaatgaaaacaatgttaatttagaccaattctattcacttataacctaa
taactctataagaatataccagcaatttaatggttaattaaatgttttactgatcctaga
ttgataaaagaaatcataatgtctccatcttctgatgctaaggaaatagttattataatc
ttagagtaatcttgtaaggttttgtttagcttagaaaaggctcatcttcatgatgttgaa
gaagagacagatttgcctaaaactttacttggataattcataaatgctcttatttattgt
ttgaatattgctgaaaactattaagaatactttgaacttatatttaggctaatataaata
gatgaagaaattgcttaatatcttctatagagaatgtttattggtagagcaatggagttc
atcttttcatctgaaggtaaaaagaaaaaaaataactagcagatgggagtaaatcagcaa
ttagatttccctaaaacacctttcagaacttcagacactccaatgatgggattaccatct
taagagaagcaaaaaaagcagtatgatagcttttacaagaaggacagatctgggtttgca
gattctacatcaattacatacttatttaggatacttgaatatcttattcttcgctcaaat
ttcgtcacaaataatccttctaagattccatcaaaaatcaattacaacctgtaaaaggat
gagatatactggctgtatagagatttggactcattgttttacttcctaaataaagcaaaa
gataaattagctattaaaagtgttaataatattttagcttatttatcatatgaagatcct
gttataattgactacatatattcaatagctgctaaaattgtataagaatattagagctaa
gaatttgtccgcagtttcactcttctaaaaaaattcttctctgtcaaagattcattttaa
ataaagaaaattgaagtggctttataaaaattgtaacaagcttgtgaatccaatttgagt
tattaaagagaatcagatgtgatataacaattcctcattaagttatgtgctgataaccat
ttagttgcttcctatatttacaaaaatcaataaatgcacttaaataattaattaaagaac
ttgcatgaatataatcccaacaaaaaagatgctgatgagaatctacaaaaaagagaccgc
tatgatttatagtattttgacatcagaattccttcaagaaccacttaacttacctgcctt
aagaattggaaaattaaataacttgaaaagctcaaatctggagattttaattttgatgta
cctcgctttgacactgatgatattatgcctgaaactgagattgttaaaggcagatactac
gatttctttgatgacaaagaaggtaaatggaaaataattagatgctacgaaatacactaa
aagaaaagaattgcttatttctttgaaattaatatttaataaatgaataattatagctta
aacgatgaaagagaattatatgaaaaggctaactcattcattatcatagttctccatcta
tctacatataaattattcccttttaaatcaatgcacgaccactttgcaatatagctataa
agtgaggaagaagaagaaaacgaagaagctgaactcaaaaagtaagaagataacgatgac
aagaaaacagaagaagaaaataactcaacaataatttaatagaataattttaatgaaccc
aacaatcaaaacgaagcttctaactgcatgatgtacaatgaataaaaccattcaggctca
gacagtgacatctaaaataaccatgcacctaactcctaagaaagagaagtaggcgaagat
taagaatctgaagatgaggaagaggaggaggaagaagaagaggaagaagaggaattagag
gaagaggaagaagaagaaaatgaagaaatacatggaacttcttcttaatga

DBGET integrated database retrieval system