KEGG   Tetrahymena thermophila: TTHERM_00388400Help
Entry
TTHERM_00388400   CDS       T01020                                 

Definition
glucose kinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tet  Tetrahymena thermophila
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TTHERM_00388400
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTHERM_00388400
   00052 Galactose metabolism
    TTHERM_00388400
   00500 Starch and sucrose metabolism
    TTHERM_00388400
   00520 Amino sugar and nucleotide sugar metabolism
    TTHERM_00388400
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    TTHERM_00388400
Enzymes [BR:tet01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TTHERM_00388400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 409 aa AA seqDB search
MLTALSKILNQHQSEYKPSTNKLSQTGEIIYKALIGDIGGTNIRLRLISFTKHARIPTVI
KSSENMKTNQFNSFTDAIAKFLEGVEEIDWPEFAGIGMAGAVLDNQNTLTNAPHWPKIIG
NELAQQFKIKKFQLFNDFEVASYACLNLTKEEVIQINTAQEIPNKIKTVCGAGTGLGVAN
IIPYPKYPESSEYVYQVWPGEGGHGSFAPITKTQQEFVDFLLKYFPERTQIALEYAFVGP
AIPYMYAFFKNRHQGSELALEKAEGAHHSFDVDEYHRMKRSKDEKEREKANFPSHLIFEY
GVQAKDAICEEVVKFFVSIYETAIGDMAVRNLPYSGIYLVGSMSLAVLPYIQKNQATFMK
EYYDNRPYLKDVFDKIPIYIVKEKDIGLDGAYVVTRQMVQSYLSSIPAQ
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgttaactgcactttcaaaaattttaaattaacattagtctgaatacaagccatccact
aacaagttgagctagactggtgaaatcatctacaaagctcttattggtgatattggtggt
acaaatattcgtctcagacttatttcttttactaagcatgcaagaatccctactgttatt
aagtcaagtgaaaatatgaaaactaaccaatttaactccttcactgatgctatcgctaaa
ttccttgaaggtgtggaagaaatcgactggcctgagtttgcaggtatcggtatggctggt
gctgttcttgataactaaaatactctcaccaatgctcctcattggcccaaaattattggt
aatgaacttgcctagtaattcaaaattaagaagttctaactctttaatgacttcgaagta
gccagttatgcttgtctcaacttaaccaaagaagaagtcatccaaattaatactgcttag
gaaatacccaacaaaattaagactgtttgtggtgctggtactggattaggtgttgctaat
atcatcccttatcctaagtatcctgaaagctctgaatatgtctattaagtatggcctggt
gaaggtggtcatggatcttttgctcctattaccaaaacttaataggaattcgttgacttc
ttattgaaatacttccctgaacgcacttaaattgctttagaatatgccttcgtaggtcct
gctattccctacatgtatgctttcttcaaaaatagacattaaggttcagaattagcttta
gaaaaggctgaaggagctcaccacagctttgatgttgatgaataccacagaatgaagaga
agtaaagatgaaaaggaaagagaaaaggctaacttccccagtcacctcatttttgaatat
ggtgtttaagcaaaggatgcaatttgtgaagaagttgttaaattctttgttagcatatat
gaaactgctattggtgatatggctgtaagaaatttaccttattcaggtatctacttagtt
ggcagcatgagtttagctgttcttccatacattcaaaagaactaagctaccttcatgaag
gaatactatgacaacagaccctacttaaaggatgtctttgataagattcctatttatatt
gtaaaagaaaaggatattggtctcgatggtgcatacgttgtaactagataaatggtacaa
tcatatctttcatcgattcctgcctagtga

DBGET integrated database retrieval system