KEGG   Tetrahymena thermophila: TTHERM_00411740Help
Entry
TTHERM_00411740   CDS       T01020                                 

Definition
oxidoreductase, FAD-binding family protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tet  Tetrahymena thermophila
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TTHERM_00411740
Enzymes [BR:tet01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     TTHERM_00411740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 301 aa AA seqDB search
MAINPGILIALTIVLATIFLFLKKKKGTAPSNSALGVVGPNGKLKVILKERQTLSHDTFN
FVFKLPNEEQIFGVPVGNHYIIHAKVNGEDVSRKYTPTSVVNQKGTFEQVIKIYRPNVHP
RFPEGGQLTPYLEKLPIGSEVEITGPHGHLEYFGNGKCVINRKLENGKIQKKTFKKMYMV
AGGTGLTPMYQIIQQVCNDPSDNTELYLLYANKSEEDILLRKELEEYAKDKRFKLFYTLD
TPPQEGWKHFGGFVTADMLKQCFPERDDNILCCSCGPVPMTNLARKLFLELGFKEENYYK
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggctattaatcctggtatattaattgctttaacaatagttttagcaactatcttttta
ttcctcaagaaaaaaaaaggaactgctccttccaattcagctttaggcgtagttggaccc
aatggaaaattgaaagttatccttaaagaaagataaactctttctcatgataccttcaac
tttgtctttaagttacctaatgaagaatagatttttggtgttcccgttggaaatcactac
attattcatgctaaagtgaatggtgaagatgttagcagaaagtatactcctacttctgta
gtaaaccaaaagggcacttttgaataagtcattaaaatctatcgtccaaatgttcatcct
agattccctgaaggtggttaattgactccatatttagaaaagcttcccattggatctgaa
gttgaaattactggccctcatggtcatttagaatattttggaaatggtaaatgtgttata
aatagaaagttggaaaatggaaaaatccaaaagaaaacttttaaaaaaatgtacatggta
gctggtggtactggacttactcctatgtattagattatttagcaagtctgcaacgaccct
agcgataacacagaactttacttactctatgctaacaaatctgaagaagatattttgctt
agaaaagaacttgaagaatatgctaaggacaaaagattcaagcttttctacactctcgat
acacctccttaggaaggatggaaacactttggtggttttgtaactgctgatatgctcaag
caatgcttcccagaaagagatgataatatactttgctgttcatgtggtccagttcctatg
actaatcttgcaagaaaacttttcttagaattaggatttaaggaagaaaattattataaa
ttttga

DBGET integrated database retrieval system