KEGG   Tetrahymena thermophila: TTHERM_00425960Help
Entry
TTHERM_00425960   CDS       T01020                                 

Definition
GTP cyclohydrolase I family protein (EC:3.5.4.16)
Organism
tet  Tetrahymena thermophila
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 223 aa AA seqDB search
MSSSNISEIANKVKQAISRKGIDNPISNSVNIYSNEEKIKKIEECFTEILNMLSLDQTDD
SICDTPSRVAKMYINEMFQGLDYANFPDMTTIDNKMEYNEMVQIQDIALTTTCEHHFITF
DGFATVAYIPKDKVLGLSKINRLVRFFSKRPQVQERLTKQILVALQTIVETEDVAVHINA
VHFCVKARGVMDQNSSTATYAYGGKFLEDKDLKKQFLDGIKRN
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaagcaacataagtgaaattgctaataaagttaaataggcaattagtagaaaa
ggtattgataatcctatctcaaatagcgtgaacatttattccaacgaagaaaaaatcaag
aagattgaggaatgttttacagaaatattaaacatgctctcattagattaaactgatgat
agcatttgtgatactccttcaagagtagctaaaatgtacattaacgaaatgttttaaggc
ttggactatgctaatttccctgatatgacaacaattgacaataagatggaatataatgaa
atggtacaaatttaagatatagctttaacaactacttgcgagcatcattttatcactttt
gatgggttcgccactgtcgcatatattcctaaagataaagtattaggattgagtaaaatt
aatagattagttagattcttttcaaaaagacctcaagtctaggaaagattaacaaagcaa
attcttgtcgctctacaaacaatagtggaaacagaagatgttgcagtgcatataaatgct
gttcatttttgtgttaaggcaagaggtgtaatggatcaaaatagctctactgctacttat
gcatatggtggcaaattcttagaagataaagatttaaagaaataatttttggatggaata
aagagaaattga

DBGET integrated database retrieval system