KEGG   Tetrahymena thermophila: TTHERM_00433560Help
Entry
TTHERM_00433560   CDS       T01020                                 

Definition
Protein kinase domain containing protein (EC:2.7.11.1)
Organism
tet  Tetrahymena thermophila
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
AA seq 1474 aa AA seqDB search
MNQAPEGYFAIIGNYYVGKTIGRGTFGKVKMGLHTYTMENIQLTFFTQVSINISKDNKQT
LQLILNNENNKVAIKILDKDKIVDESDKIRVAREIQILRKIRHPNIIQLYEVNFQNLYFG
IIQQFEQFIKYQDQIVFNLLLKQIIESQTQLFLITEYAPNNELFDFIVKRNSQLFIKNKH
NRLNERQSARFLLQILSAVEYLHQNNIVHRDLKPENLLLDCNNNIKVVDFGLSNMYEDGQ
TLKTACGSPCYAAPEMVSGKRYEGLKTDIWSCGIILYAMLCGYLPFEDSNTTDLYKKIIN
DPVKLPKFLTDRSKSILNGILEKNPEKRLTIEAIRKHDFCILNSNQPILKGIIFGKDDIL
VDPLILQIIKNQYGIDSEQARVMIQNNKHNQITATYYLLLNSHIRNGGVSIADLSRPPPK
KTLSLNQENNQKETNESSSKKIQEQNTILMENKDKNGLQQDKQSVNINYSERVSAMNKQA
PNKSSTPIKKGVDNKPPLQNFEQYVALQQRINKEKQKDSTPESKGKNGSYLNSPLIQSPE
QNSKNADARILKEDKQPFVVVKSPLKNKQISYDESESSNKSPNISPNTNKSKYQDLQSSQ
KEKQSGEINFIKGYSLTESTVRKQNFFQEEEQINNISATKDKQNIQNIDVENQINNQQAY
TSTFGSGFKLSEKGSPIRKVKLNNIQQQQFQQSLQKGDTNIQKCIIDKNEENIKLDKQKS
QESENLLSEKSLSKNNEKSDDEQLAEKSPIKETKMQIEGENKIRNQNVVATETKSASLDK
KQINKTNNQNQQKVNGVNNLYNIQISKLHYNKAGQKARNGQESTSEISANKSDNQVTLQN
NSDIYQRTDANINVQNYKISSASRRGNSSKEESVTTQLQLQIIQQSENPQQINQISNTNQ
SKIIVKIHQKTKSETGFSRKLMNINGINQKENVNNESEEISNMKSPQLKSSVAASSAHSQ
VNSQIKNTNEKIANLIRSANQKGGINAFQKDVSAQSQYKQYLPVFFNNQQYSSSLNAPNT
SNSIINNTINSSNINNNTIETEKQQQNQSSNNYYSKQTLKTPCITEPTYHETNSIRQKLK
IISQRNSTQGTSAQAFKVRIRKSATPELNNINSSINNNSNQSNIQNTLFVNGSHNLVSQQ
QKRSNSNNNITNNQNSATGNSSNLQTSPEKKFKTKQISRSSRRFVSAERENNQMIQQSLV
DDPTKNKFFRQGSSSIQKNIQNYLNIIEKNSASNMNNIHNTDKQNINVVIKKPENIDNNG
QSFQSEMKKQDQTNNQTPSINKEVKEPKIRVISESPMCKKDQHSNESKYYLGLKQQMIQK
EPLICNFSINNDSNINHHLTNNDGINSTIDDIVQQKSNQKLTSWPHSQNYYLNAPVTHSN
NKSYLNNISNSSRISSQLNEQQLQSLQPPTMENSRSEHLKFKAVTNSLISNSYSLVNVQK
YKVRKSKINSGLHNISNSIMSVNNAISNHTKDKI
NT seq 4425 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagccccggaaggatattttgctattatagggaattactatgttggcaaaaca
atagggagaggcactttcggaaaggtcaaaatgggccttcatacttatacaatggagaat
atttagttgacttttttcacacaagtttcaatcaatatcagcaaagacaacaaacaaaca
ttataattaattttaaataatgaaaataataaggtggctatcaaaattttagataaagac
aaaatcgtagatgaatcggataaaattagagttgcaagagagatttaaattttaagaaaa
attaggcatccaaacataatttagctctacgaagtaaatttttagaatctttattttggc
attatttagcagtttgaataattcattaaatactaggattaaatcgtttttaatttgcta
ttaaaatagattattgaatcgtaaacatagctttttctcataactgaatatgctccaaac
aatgaactctttgatttcattgtgaaaagaaacagttaattatttattaaaaacaaacac
aacagattgaatgaacgataatctgcaagatttctcttgtaaattcttagtgctgttgaa
tatctgcattaaaataacatagttcatagagatctcaagcctgagaatctcctacttgac
tgcaacaacaatataaaagttgttgattttggattaagtaacatgtatgaagatggctaa
actttaaagacagcttgcggatcaccatgttatgctgctccagaaatggtgagtggaaaa
agatacgaaggattaaagacagatatttggagttgtggaattattttatatgcaatgctt
tgtggttatcttccatttgaagactcaaatactacagacttatataaaaagattatcaac
gatccggttaagttgccaaaatttttaactgatagatcaaagagcattttaaatggaata
ctagagaaaaatcctgaaaagcgcttaacgattgaggcaattagaaaacatgatttttgt
atattgaacagcaatcaaccaattttaaaaggaataatttttgggaaagatgatatcttg
gtagatcctttaattttacagattattaaaaattaatacgggattgatagtgaataggct
agagtgatgattcaaaataataaacacaattaaataacagctacttattatttactttta
aatagtcatattagaaatggaggagtcagcatagctgatctatccagacctcctccaaag
aagactctttcattgaattaagaaaataattaaaaagaaacaaatgaatcttcgagtaaa
aagatttaagaataaaatacaattttaatggaaaataaagataaaaatggtttataataa
gataaataatctgttaatatcaattattcagaaagggtcagtgctatgaataaataagct
ccaaataaatcttctacacctataaaaaaaggcgtagataataaacctcctttataaaat
tttgaataatatgtagcattgtaataaaggataaataaggagaaatagaaagattctact
cctgagagtaaaggaaagaatggttcttatttgaattctccattgatttaaagtcctgaa
taaaactcaaagaatgcagatgcaagaatattaaaagaagacaaatagccttttgtcgta
gtaaaatctcctctcaaaaataaataaatatcttacgatgagagcgaaagtagcaataaa
tctccaaatatctctcctaatacaaacaaaagcaagtattaggatttacaaagtagtcaa
aaagaaaaatagagtggagaaattaattttataaaaggttatagtttaactgaatcaaca
gtgagaaaataaaatttcttttaagaagaagagcaaattaacaatatttctgcaacaaaa
gataaataaaatattcaaaacatagatgttgaaaattaaattaacaactagcaagcttat
acatcaacttttggcagtggcttcaaattaagcgaaaaaggaagtccaataagaaaagta
aagctgaacaacattcagcagtagtagttttagcagtctttataaaaaggtgatacgaat
atccaaaaatgtataattgataaaaatgaagaaaatataaaattggacaaataaaaatct
taagagagtgaaaatctgctttctgaaaaaagtttatctaaaaataacgaaaaatcagac
gatgagcaattagctgaaaaatcaccaatcaaagaaacaaaaatgcaaatagaaggtgag
aataaaataagaaattaaaatgtagttgcaactgaaacaaaatcagcttcactagataaa
aaacaaatcaataaaacaaataattaaaatcaataaaaggtaaatggtgttaataattta
tacaatatttagatctctaaattgcactataacaaggcaggacaaaaagctagaaatggt
taagagagtacttcagagatatctgctaataaaagtgataactaagttactctctaaaac
aactcagatatatatcaaaggactgatgcaaatataaatgtttaaaattataaaatatcc
tctgcttctcggagaggtaattcttccaaagaagagagtgtaacaacctaattgtaattg
taaataatttaataatctgaaaatccttagcaaataaattagatttcaaacacaaattaa
tcaaaaatcatagttaaaatccatcaaaaaacgaaaagtgaaacaggcttctcgagaaaa
ttgatgaatataaatggcatcaattaaaaagaaaatgtaaataacgaatctgaagagatt
tccaacatgaaatcgccttaattaaaatcttctgtagccgcttcttctgctcattcacaa
gtaaatagctaaattaaaaacactaacgaaaagattgcaaatcttattcgttctgccaac
taaaagggaggaattaatgcattttaaaaagacgtgtctgcttaaagccaatacaaataa
tatctccctgtatttttcaataatcaacaatattcttcttcgcttaatgcaccaaatact
tcaaatagcatcataaataatacaatcaacagtagcaatatcaacaataacactatcgaa
acagaaaaacagcaacagaactaatcctcaaacaattattattctaagcaaaccttaaaa
acaccttgtatcacagaaccaacttaccatgaaacaaattctatcagataaaaactaaag
ataataagccaaagaaacagcacttaaggaacttctgcataagctttcaaagtaagaata
agaaagagtgctactcctgaattgaataacataaatagcagtatcaataacaacagcaat
taatcaaatatttaaaacacactatttgtaaatggttcacacaatttagtatcatagtaa
caaaaaagaagcaatagcaacaacaatattactaacaattaaaactctgcaacaggcaat
tcaagcaatctccaaacctctccagaaaagaaattcaaaacaaagtagatatctaggtca
tcaagaagatttgtttcagctgaaagagaaaataattaaatgattcaataaagtcttgtt
gatgatccaacaaaaaataaattcttcagacaaggttcaagtagcatatagaaaaacata
taaaactatttaaatataatcgaaaaaaatagtgcaagcaatatgaacaacattcataac
acagacaaataaaatataaatgttgtgattaaaaaaccagaaaatattgataataatggc
taaagttttcaaagtgaaatgaaaaagtaagattaaaccaataactaaacaccttctata
aacaaagaggtgaaggaaccaaaaataagagttataagtgagtctccaatgtgtaaaaaa
gaccagcactcaaatgagtctaaatactatttagggttaaaataacaaatgatttaaaag
gaacctttaatatgcaattttagcataaataatgattcaaatataaatcatcatttaacg
aataatgatggtataaattctactattgatgatattgtgtaataaaaaagtaattaaaag
cttactagctggccacattctcaaaactattacttaaatgccccagtaacacattcaaac
aacaaatcttatctaaataatatcagcaacagcagcagaatttcttcttaactcaacgaa
caataattataatcactctaacctccaacgatggaaaatagcagaagtgaacacttgaaa
ttcaaagctgtgacaaattctctgataagcaattcttactctcttgtgaatgtttaaaaa
tataaagtcagaaaaagtaaaataaattctggattgcataacataagcaacagtatcatg
tctgtaaataatgcaattagtaaccatactaaagataaaatatga

DBGET integrated database retrieval system