KEGG   Tetrahymena thermophila: TTHERM_00442520Help
Entry
TTHERM_00442520   CDS       T01020                                 

Definition
Ubiquitin carboxyl-terminal hydrolase family protein
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
tet  Tetrahymena thermophila
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 1039 aa AA seqDB search
MSNQKGEIPESILNDYLQMGLNEQLLRLAYRNCKGQVNSLLDEYQHLLASNNQVLNEQQN
KISNLTDNMDEEVQLNQAILASQQEAKEKNISFEPLNPEQRIRKEGIPVGLKNLGNTCYI
NPLLQSYFYNAEFCYAIINFQKPSEEEIQKRLKNDSTQSNSSDEQFQKDSTEQNILLKRV
KASVELVCALQELYILLVGSDKKYIDPSKVIKNIVDEQGNQIQIGDQQDIGEFNLTFLAR
IDEGLSYSKKSFNKGAMEEELVHSLMRASSTSISQGEQELQRSISISMSDTSVVNSNFFG
KASIHMSYPLGEETFEKQEEELFNIIFLDIKHKELYYALDEYVVNHIDEFKNDKGDIVQA
QKYNWIKRAPKTLFFQLQRVVFDKEKGCLKKLNDSFNFENQIYLERFTEERSKDYLRIRE
QVNKLIYEKQQYELALNNINQYSNHLSQNQTKSNAKPEENKDQQSNLGLLSALESTILFL
QTNSKKVDVNPLVDPSYFGDNSKENLQIVKALEQYTSKVKQRIQELQEKIRQLENKINES
YNGFKKEKYLLQSVIIHDGQADSGHYYAFIKDHSTKKWWRYNDIQVSEETEENVFKEALG
GWGKASAYSLIYVKEEVAIPPQAKEKPIRLHLASNTVNQLSASQVRTVDYYTSIIPEDLL
NNLCVENLKFQEEIEEYKASNTSRQIIDMYTRRFELNNECARKGDEARKKVKGSPPPFIQ
FCVYLKLHPKNDKGQFDDLIKWLILDSCVREHYKNAQHLNNLSDKKLEDKLKQQIASLGN
FKAPKSIKISAENSDTIEQINSEFIKQLNNAEATIFAMQAALKFDWISSLAAFDYLIDLN
FFSDQNKQAQFKDDYFFKISRDTKLIILIAMLHYYELKVPFCTKEDSQEILNGIQVFIGF
YKKQNKPDQKTQVTFSLWIDDISQLASDQNLQQEIKKINSEYMSASNNNRYIQGEEPLKN
IPTELKERLEKLTSEGDMYYWNANKKEDYLFNELISNFDKIKAHFDTYIKFIQKIRASQT
PLFKQDRLFSTNVQSYNIK
NT seq 3120 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattaaaaaggagaaataccagaatcaattctaaatgattatttataaatgggg
ctaaatgaatagcttctcagattagcttatagaaactgtaaaggctaagttaattccctt
ttagatgagtatcagcacctattagccagcaataattaggtattaaacgaatagcaaaat
aaaattagcaatttaacagataatatggatgaagaagtttaactgaattaagctatctta
gcttcttaacaagaagcaaaagaaaaaaatattagctttgaacctcttaatcctgaataa
agaattagaaaggaaggaataccagttggcttgaagaatttaggaaatacttgctacata
aatcctctcttgcaatcatatttttataacgctgaattctgctatgccatcattaatttc
caaaaacctagtgaagaagaaatttaaaagcgcctcaaaaatgactctacttaaagtaat
tcatctgacgaataattttaaaaagatagcacagaataaaacatacttttaaagagagtg
aaggcatctgtcgagttagtgtgtgcattacaagagttatatatattactagtaggaagt
gacaaaaagtatattgatccttctaaggtaattaaaaatatagtagacgagcaaggtaat
taaatataaataggtgattagtaagacataggtgaattcaatcttacttttttagcaaga
attgatgaaggtcttagctactctaaaaaatcatttaataaaggagctatggaagaagaa
ttagttcacagtctaatgagagcttcttctactagcatatcctaaggtgagtaagaattg
taaagaagcatttctatttctatgtcagacactagtgtagttaattcaaacttttttgga
aaagcttctatccacatgagctatccattaggtgaggaaacttttgaaaaataagaagag
gagttgtttaacatcattttcttagatatcaagcacaaagaactttattatgctttagat
gaatacgtagttaatcatatcgacgagtttaagaatgacaaaggtgatatagttcaagct
taaaaatacaactggataaaaagagcacctaagacccttttcttttaacttcagcgtgtc
gtatttgataaagaaaaaggatgcttaaaaaaactaaatgatagtttcaactttgagaat
taaatctacttagagcgttttactgaagaaagaagcaaggattacttaagaattcgtgag
taggtaaacaaattaatatatgaaaaatagcaatatgaattagctcttaacaacattaac
caatactcaaatcatctttcatagaattaaactaaatctaatgcaaagccagaagaaaat
aaagatcaacaaagcaacttaggacttctgagtgctttagaaagtactattttattcctt
taaactaatagcaaaaaggttgatgtcaatccattagtagatccttcatattttggagat
aattccaaagaaaacctttaaattgttaaagcccttgaataatatactagcaaggtaaag
taaagaatccaagagctgcaagaaaaaatcagataactagaaaataagattaatgagtca
tacaatggatttaaaaaagaaaagtatttgctctagagcgttatcattcatgacggataa
gctgatagtggtcattactacgcattcattaaagatcactctaccaagaagtggtggcgt
tataatgatatacaagtaagtgaggaaacagaagaaaatgttttcaaagaagctctagga
ggatggggtaaggccagtgcatacagtttaatctatgtgaaagaggaagttgctattcca
ccttaagcaaaagaaaaacctattcgcttgcatttagcttcaaatacagtcaattaactg
tcagcatcttaggttagaacagtagattactatacttctattattcctgaagatcttttg
aataatttgtgtgtagaaaacttgaaattctaagaagaaattgaagagtataaagcaagc
aatacttctcgttagattatagatatgtatactcgccgtttcgagcttaacaatgaatgt
gctcgcaaaggagacgaagcccgtaagaaagttaaaggctctccacctccattcatctaa
ttctgcgtctatctaaagctacatcctaaaaatgacaagggctaatttgatgatctgata
aaatggcttattcttgatagttgtgtcagagaacactacaaaaatgcctaacacttaaat
aatttaagtgacaaaaagctagaagataagcttaaataataaatagcctctcttggtaat
ttcaaggcacctaaaagtataaaaatatctgcagaaaattctgacacaatagaataaatc
aattctgaatttatcaagtagcttaataatgcagaagctactatattcgcaatgtaagct
gctttgaagtttgattggatatcatcgctagcagcttttgattatttaattgatcttaac
tttttctctgactaaaataagtaggcttaattcaaagatgattatttctttaagatttct
cgtgatactaagctaatcattcttatagctatgctccattactatgaacttaaggtacct
ttttgcactaaagaagatagccaagagattttgaatggaatttaagtatttattggattc
tacaaaaaataaaataagccagatcagaagacctaagttacatttagtctttggatagat
gacatctctcaattagccagtgaccaaaatttgcaacaagaaatcaaaaaaattaactct
gaatacatgtctgctagtaacaacaaccgttatatttaaggtgaagaaccattaaagaat
atacctactgaacttaaagagcgtttagaaaaacttacatcagagggtgatatgtattat
tggaatgcaaataaaaaggaagactatttgtttaatgaattaatttcaaactttgataaa
ataaaagctcattttgatacctacatcaaatttatttaaaaaatccgtgcctcctaaacc
ccattattcaagcaagacagactcttcagtactaatgtctaatcatacaacataaaatga

DBGET integrated database retrieval system