KEGG   Tetrahymena thermophila: TTHERM_00442770Help
Entry
TTHERM_00442770   CDS       T01020                                 

Definition
(RefSeq) CGMP-dependent kinase 5-1
  KO
K07376  
cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
tet  Tetrahymena thermophila
Brite
Enzymes [BR:tet01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     TTHERM_00442770
Protein kinases [BR:tet01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   TTHERM_00442770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 854 aa AA seqDB search
MGNCFVSKPSSRDNSTTKEKVVDHNELKVDLQEVQEEQQKQQVVKEEKQVAVNSAKTQEE
PQEPKQEAQDKSADKYIDKSADKSQINQNNVSQDDSAKPDPEDKKKKRNKVKAKKVRADI
EEESQIYENIIKREREMTNADIHANKKSLGNHFVFSLLSDQDKEEIIKKMFYCENKSDFV
FKQGDQASTYFIIEKGECQIIINGDVKRTLQHGQCFGELALLYGAPRSASVKALGVCGFW
AIDRNTFKKAIAEVVHREYGENRSFIDKIKFFNSMTNEQKDSIANVLITQVFKKGEIIVA
DGDMASSYYIIKKGKVAIYKDEKMIREMVAGETFGEQALFENSKRGATVKAVEDDSRCIA
LGKDDIQRVLGDKVQVIMYNNMIKWAFEGNEILKKLTKVQKEKIVINQKQTNYQKGVICF
PAGQPVQKLIFLLEGSIAYEGGNKIAEKGGLFGDHWLLQKYKDEKLSKNVIFSEDTLLAE
ISFQQLYEQIGGKNIEEIIDKNKDSHEVKYMKRANSKDLNKEYEHLKLEDMISIKKLGFG
QFGSVYLVKSKSDSNYYALKCISKAQVIEQSLEKHLLQEKKVLESAQFPFIMKFIRTFRD
NNNVYFLVEYVRGMELFDVIREIGLLNTYDSQFYIGSLLLCIEYLHTNSIIYRDIKPENI
MIDYKGYMKLIDMGTAKFLKGKSGRTFTIIGTPHYMAPEIITGKGYSYSVDLWSIGICLY
EFMCGAVPFAEDADDPYEIYEEIIKKPLQYPGFLKDKNSKTLMNQLLNKTPELRLGGSYA
ALKANPWFDNFDFDKLMERQLRAPYVPPKDKLISEAEIKKMEGIRKLVMDEIKHENTSRY
RKENAKDPNWDKDF
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgggaaattgttttgtctcaaagccatcaagcagagataacagtactacaaaagaaaag
gttgtcgaccataatgaacttaaggttgacctttaagaagttcaagaagaacaacaaaaa
taataagtagttaaagaagaaaaataagttgcagtaaatagcgctaaaacttaagaagaa
ccataagaacctaagtaagaggcttaggataaatcagcagataaatatattgataaaagt
gctgataaatcatagatcaattaaaacaatgtttcataagatgattcagcaaaaccagat
cctgaagacaaaaagaagaaaagaaataaagttaaagctaaaaaagttagggctgatatt
gaagaagaatcttagatttatgaaaatattatcaaaagggaaagggaaatgacaaatgct
gatatccacgccaataaaaaatcgctaggaaatcattttgtgttttcattactttcagac
taagataaggaagaaattatcaaaaaaatgttctactgtgaaaacaaatcagattttgta
tttaagcaaggagaccaagcatctacctacttcattatagaaaagggagagtgttaaatt
attattaatggagatgtgaagagaactctataacatggttagtgctttggtgaacttgct
ctgctttacggagctcctagatctgcctctgttaaagctctaggtgtttgtggattctgg
gctatcgatagaaacactttcaaaaaagctattgcagaagtagtacatcgtgaatatggt
gaaaatcgttcattcattgataaaatcaaattcttcaactctatgactaatgagtaaaag
gattcaattgcaaacgttcttattacttaagttttcaagaagggagaaattattgttgct
gatggtgatatggctagttcatattatattataaagaaaggaaaggtagcaatttacaaa
gatgaaaagatgatccgtgaaatggtagcaggagaaacttttggtgagtaagctcttttt
gaaaattctaagagaggtgctacagttaaagcagtggaagatgattctagatgcatagct
ttaggaaaagatgatatccaaagagttcttggtgataaagtttaagttattatgtataat
aatatgattaagtgggcctttgaaggaaatgaaattttaaaaaaacttactaaggtttaa
aaagaaaaaattgtaattaattaaaagtaaaccaattactaaaaaggagtaatttgtttc
ccagctggatagccagtctaaaagcttatatttttattagaaggttcgattgcatatgaa
ggaggaaataaaattgcagaaaagggtggattgtttggtgatcactggcttctctaaaaa
tacaaagatgaaaagctaagcaaaaatgttatatttagtgaagatacacttttagctgaa
atatcattctaataattatatgagcaaattggtggtaaaaatattgaagaaatcatagat
aaaaacaaagattcccatgaagtcaagtatatgaaaagagctaactctaaggatttaaac
aaagaatatgaacatttaaagctagaagacatgatttctattaaaaaattaggttttggt
caattcggtagcgtttatttagtcaaatcaaaatcagattccaattattatgctttaaag
tgcatttctaaagcttaagttattgaacaaagtttagaaaagcatcttttataagaaaag
aaagtacttgaaagtgctcaattccctttcatcatgaaatttattagaacttttagagac
aataataatgtatatttcttagtagaatacgttcgtggtatggaactctttgatgttatc
cgtgaaataggtcttctaaatacttatgattcttagttttatattggatctcttcttttg
tgtattgaatatctccatactaattctattatttacagagatattaaacctgaaaatatc
atgatagactacaaaggatacatgaaacttattgatatgggtactgcaaaattcttaaaa
ggcaaaagtggaagaacttttactatcattggtactccacattatatggctcctgaaatt
attacaggtaaaggttattcttatagcgttgatttatggtcgattggtatttgcttatat
gaatttatgtgtggtgctgtgccatttgcagaggatgctgatgatccatatgaaatttat
gaggaaattattaaaaaacccctgtaataccctggctttttaaaggataagaactcaaaa
actcttatgaatcaattgctaaataagactcctgaactccgtttaggtggttcatatgct
gcccttaaagctaatccttggtttgataactttgactttgataaattaatggaaagataa
ctcagagctccatatgtccctccaaaagataagttgatatcagaagctgaaatcaaaaaa
atggaaggtatccgcaagttagttatggatgaaataaagcatgaaaatacatctagatat
agaaaagaaaatgctaaagatcctaactgggataaagatttttga

DBGET integrated database retrieval system