KEGG   Tetrahymena thermophila: TTHERM_00467500Help
Entry
TTHERM_00467500   CDS       T01020                                 

Definition
ARD/ARD' family protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
tet  Tetrahymena thermophila
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:tet00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 400 aa AA seqDB search
MNGLSSNSGPREVICALLRNFYTQGWCAGSGGGISIRKSDDEIYVAPSGVQKELVQPEDI
YVINVNGDVVENPKNPKLKPSECTPLFNAAYKLRRAGAVLHSHALPAMLVTKLFGTEFQT
IDHEMIKGIPNHHNTEWCVVPIIENTEKECELTERLTNAINAYPRSNAVLVRNHGVYIWG
ENWEKAKIHAECYHYLFEAVVEMKKLGLEIPRTVSSSSQLRAWYIDENAIGQDGDIRESL
HYRSYKWVNPEYLATIGVEHWKLDGEENNTELERVCKQRNYSSRDQIKCGNHCENYQQML
SNFRKEHIHLDEEIRYIIGGSGYFDVRDHEDKWIRIQSVKGDLIVLPEGIYHRFTTDKND
GVHAMRLFKDEPKWTPYNRPCDELESRNKYVDQFLKKFQK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaacggtttatcttcaaattctggtcctagagaagtcatttgtgctctcttgagaaac
ttttatacttaaggatggtgcgctggttcaggtggtggtatatctattagaaaaagcgac
gatgaaatatatgttgcaccttcaggtgtataaaaagaattggtttaacctgaagatatc
tatgttattaatgttaatggagatgtagttgaaaaccctaaaaatccaaaattaaaacct
tctgaatgcactcctctttttaatgcagcttataagcttcgtcgtgctggtgctgtttta
cattctcatgctcttcctgcaatgctagttaccaagctctttggaactgaattttagaca
attgatcatgaaatgattaaaggtattcctaatcaccataatacagaatggtgtgtcgtc
cctatcattgaaaacactgaaaaggaatgcgaattaacagaacgtttaactaatgcaatc
aacgcttatcctcgttctaatgctgtcttagttcgtaatcacggtgtttatatttgggga
gaaaattgggaaaaagcaaaaatacatgctgagtgttaccattatttattcgaagcagtt
gttgaaatgaagaaattaggtttagaaattccacgcactgtttcaagcagtagccaatta
cgtgcttggtatattgatgaaaatgcaattggccaagatggtgatattcgtgagagctta
cactatcgctcatataagtgggttaatccagaatatttggcaacaattggtgttgaacac
tggaaattagacggagaagagaataatactgaacttgaaagagtttgcaaataaagaaat
tactcttctcgtgattaaattaaatgtggaaatcattgtgaaaattactaacaaatgtta
tcaaatttcagaaaagaacacatccatttagatgaagagattcgctatattataggtggt
agtggttattttgatgtccgtgaccatgaagataaatggattcgtatccaaagtgttaaa
ggtgatttaattgtacttcctgaaggtatatatcaccgctttacaactgataaaaatgat
ggagttcatgctatgagattatttaaggatgaacctaaatggacaccttataatcgtcct
tgtgatgaattggaaagccgtaacaaatatgtagattaattcttaaaaaagttttaaaaa
tga

DBGET integrated database retrieval system