KEGG   Tetrahymena thermophila: TTHERM_00471920Help
Entry
TTHERM_00471920   CDS       T01020                                 

Definition
Ubiquitin carboxyl-terminal hydrolase family protein
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
tet  Tetrahymena thermophila
Brite
Enzymes [BR:tet01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TTHERM_00471920
Peptidases [BR:tet01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TTHERM_00471920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 505 aa AA seqDB search
MVKVVLKWGTKNIEAELDQSLPVIKFQEIVYSLTRVPIASQKIIFKGTLFKPETDLSKLK
LQEGSVITLMGAAEENEIKEIKEEKKFYEEMTPEERALIYKEKTGEILPAGLANMGNTCY
MNSSIQCLKRINELKNFLQNRQIPAGQGAQGLVGIALQRLFRDLDKKGEAVKPIHFIQSF
MTAFPQFAEKEQGSIAFKQQDADECFQNVIQCIEPQTNYEDELGNKTNLIKDIFEIEFEV
KQTNNDNIQEVSVKSERSKKLMCTIDNQSNPVNQLTEGIEVSLQGTVQKNGQDGLLHDFT
ETRRIKKLPSYLAIQMMRFFWKQKSESSRTEATKSKILRSVAFPKILDVTPYCTQDLQAA
IEKGKDYEKRQQEQANKNTEEKFAEYKRKLESEGKMIPEDTKALYKQFKEVQKEEDIKQH
DENLYRPHGQGLDNGTYELVAVLTHQGRSADSGHYVGWAHKSGDVWQRFDDDVVTEVSID
EILDLRGGGDRHMAYYLIYRKLEIL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggttaaagtagttttaaaatggggtacgaaaaatatagaagctgagttagattagagt
cttccagtgattaaattttaggaaatcgtttactcattaactagagttcctattgcaagt
taaaaaattatttttaaaggaaccctcttcaagcctgaaactgatctctctaaacttaaa
ttgtaagaaggtagtgttattacattgatgggagcagctgaagaaaatgaaattaaagaa
atcaaagaagagaaaaagttctatgaagaaatgactccagaagagcgcgctttaatttac
aaagaaaaaacaggagaaattttacctgctggtcttgcaaatatgggaaatacttgctac
atgaatagttcaatctagtgcctaaagagaattaacgaattaaagaacttcttataaaat
agatagatacctgcaggttaaggagcttaaggtttagtaggtatagctctttaaagattg
tttagagacttagataagaaaggtgaagcagttaaaccaatacactttatctaaagtttt
atgactgcattcccataattcgctgaaaaagaataaggttccatagcttttaagcaataa
gatgctgatgaatgcttttaaaatgttatttaatgtattgaaccttaaacaaactatgaa
gacgaacttggtaacaaaaccaatttgataaaggatatttttgaaatagaatttgaagtc
aaataaacaaataatgacaatatttaagaggtatcagtaaagagtgagcgttctaaaaaa
cttatgtgcacaatcgataactaatcaaatccagttaactaactcactgagggtatagaa
gttagtctttaaggtacagtataaaagaatggacaagatggattgcttcacgattttacc
gaaactagaagaattaagaaattaccaagctacttagctatttaaatgatgagattcttc
tggaaataaaagtctgaaagctcacgtactgaagccactaaatctaaaatccttcgtagt
gtagccttcccaaaaatattagatgtaacaccttactgtacttaagatttacaagcagct
atcgaaaaaggaaaagattatgaaaaaagatagtaagaataagcaaataaaaacacagaa
gagaaatttgctgaatataaaagaaagcttgagtctgaaggaaaaatgataccagaagat
actaaagctctttataaacaatttaaagaagtataaaaagaagaagatatcaaatagcat
gatgaaaatctctatagacctcatggttagggtttagataatggtacttatgaattagtt
gcagtattaactcactaaggaagaagcgctgactcaggccattatgttggatgggctcat
aaatcaggagatgtttggtaaagatttgatgatgatgtagtaactgaggtttctattgat
gaaattcttgatcttagaggaggtggtgatagacatatggcctattatttaatttatcgt
aaactagaaattctttga

DBGET integrated database retrieval system