KEGG   Tetrahymena thermophila: TTHERM_00475140Help
Entry
TTHERM_00475140   CDS       T01020                                 

Definition
protein disulfide-isomerase domain containing protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
tet  Tetrahymena thermophila
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:tet04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 485 aa AA seqDB search
MNKTLLLLTILAVGALASTAPAVEEGVYVLTDSNFNEFIASKPFVLVEFYAPWCGHCKKL
APEYAKAAQALASENSQAVLAKVDATEQKDLGTRFSIQGFPTLKFFINGSTENPVDFNGG
RTEKDILNWIKKRTGSVSEALNTAEELTAFTQKNQVAIVYFGESEKDANYEAFKSLAMSY
DDLAFAHVFNADLRTAQNAAAHNLVLYKHFDEKRNDFTGTFNVANLKTFVDTNSFPIVMP
FNDRAIQKVFQQGNPTLFLFSNSNEASLAAEKAFAASAEENRGKIVFSISKPDDTFGHYQ
KLADYIGVNTAQVPALMLVHSSHEVLKYKFTASEITHATINQFVSDYLAGKLSTYLKSED
IPATNDEPVKVLVGKSFDDLVINSNKDVLVEFYAPWCGHCKQLAPIYDAVAKKLSHNHNI
VIAKIDSTANEVPGVNIRGFPTIKFYQNGKKSTPLDFEGDRTEEGILKYLKEKTTFPWVE
KNEDL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagactttgcttttgttaactattttggctgtcggtgctttggcttccactgcc
cctgctgtcgaagaaggtgtctatgtcttaactgactccaacttcaacgaattcattgcc
tccaagccttttgttttggttgaattctacgccccttggtgtggtcactgcaagaagctc
gcccccgaatatgctaaggctgcttaagctttagccagtgaaaactcctaagctgttctc
gctaaggttgatgccactgaataaaaggacctcggtactagattctccatccaaggtttc
cctaccttgaagttcttcatcaacggttccactgaaaaccctgttgacttcaatggtggt
agaactgaaaaggacatccttaactggatcaagaagagaaccggttccgtttctgaagct
cttaacactgctgaagaattaaccgccttcactcaaaagaaccaagtcgccatcgtttat
ttcggtgaaagtgaaaaggatgccaactacgaagccttcaagtctttggctatgtcttat
gatgacctcgccttcgctcacgttttcaacgctgacttgagaactgcttaaaacgctgct
gctcacaacctcgtcctctacaagcacttcgatgaaaagagaaacgacttcactggtacc
ttcaacgttgctaacttaaagactttcgttgacaccaactctttccccatcgttatgccc
ttcaacgacagagccatccaaaaggtcttctaacaaggtaaccccactttgttccttttc
tccaacagcaacgaagcttcccttgctgctgaaaaggctttcgctgcttctgctgaagaa
aacagaggtaagatcgtcttctctatctccaagcctgatgacaccttcggtcactactaa
aaactcgctgactacatcggtgttaacactgcttaagtccccgctttaatgctcgttcac
tccagccacgaagttcttaagtacaagttcactgcttctgaaatcacccatgccaccatt
aactaattcgttagtgactaccttgctggtaagctctcaacttacttgaagtctgaagat
atccctgccaccaacgacgaacccgtcaaggtcctcgtcggcaagagtttcgatgacctc
gtcattaacagcaacaaggatgtcttagttgaattctacgctccctggtgcggtcactgc
aagcaacttgctcccatctatgatgccgttgccaagaagctctcccacaaccacaacatc
gtcatcgctaagatcgattccaccgctaacgaagttcccggagtcaatattagaggtttc
cccaccattaagttctatcaaaacggtaagaaatctactcctcttgatttcgaaggtgac
agaactgaagaaggtatcctcaagtacctcaaggaaaagaccaccttcccttgggttgaa
aagaacgaagatctctga

DBGET integrated database retrieval system