KEGG   Tetrahymena thermophila: TTHERM_00475140Help
Entry
TTHERM_00475140   CDS       T01020                                 

Definition
protein disulfide-isomerase domain containing protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
tet  Tetrahymena thermophila
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tet00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    TTHERM_00475140
Enzymes [BR:tet01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TTHERM_00475140
Exosome [BR:tet04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   TTHERM_00475140
  Exosomal proteins of colorectal cancer cells
   TTHERM_00475140
  Exosomal proteins of bladder cancer cells
   TTHERM_00475140
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 485 aa AA seqDB search
MNKTLLLLTILAVGALASTAPAVEEGVYVLTDSNFNEFIASKPFVLVEFYAPWCGHCKKL
APEYAKAAQALASENSQAVLAKVDATEQKDLGTRFSIQGFPTLKFFINGSTENPVDFNGG
RTEKDILNWIKKRTGSVSEALNTAEELTAFTQKNQVAIVYFGESEKDANYEAFKSLAMSY
DDLAFAHVFNADLRTAQNAAAHNLVLYKHFDEKRNDFTGTFNVANLKTFVDTNSFPIVMP
FNDRAIQKVFQQGNPTLFLFSNSNEASLAAEKAFAASAEENRGKIVFSISKPDDTFGHYQ
KLADYIGVNTAQVPALMLVHSSHEVLKYKFTASEITHATINQFVSDYLAGKLSTYLKSED
IPATNDEPVKVLVGKSFDDLVINSNKDVLVEFYAPWCGHCKQLAPIYDAVAKKLSHNHNI
VIAKIDSTANEVPGVNIRGFPTIKFYQNGKKSTPLDFEGDRTEEGILKYLKEKTTFPWVE
KNEDL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagactttgcttttgttaactattttggctgtcggtgctttggcttccactgcc
cctgctgtcgaagaaggtgtctatgtcttaactgactccaacttcaacgaattcattgcc
tccaagccttttgttttggttgaattctacgccccttggtgtggtcactgcaagaagctc
gcccccgaatatgctaaggctgcttaagctttagccagtgaaaactcctaagctgttctc
gctaaggttgatgccactgaataaaaggacctcggtactagattctccatccaaggtttc
cctaccttgaagttcttcatcaacggttccactgaaaaccctgttgacttcaatggtggt
agaactgaaaaggacatccttaactggatcaagaagagaaccggttccgtttctgaagct
cttaacactgctgaagaattaaccgccttcactcaaaagaaccaagtcgccatcgtttat
ttcggtgaaagtgaaaaggatgccaactacgaagccttcaagtctttggctatgtcttat
gatgacctcgccttcgctcacgttttcaacgctgacttgagaactgcttaaaacgctgct
gctcacaacctcgtcctctacaagcacttcgatgaaaagagaaacgacttcactggtacc
ttcaacgttgctaacttaaagactttcgttgacaccaactctttccccatcgttatgccc
ttcaacgacagagccatccaaaaggtcttctaacaaggtaaccccactttgttccttttc
tccaacagcaacgaagcttcccttgctgctgaaaaggctttcgctgcttctgctgaagaa
aacagaggtaagatcgtcttctctatctccaagcctgatgacaccttcggtcactactaa
aaactcgctgactacatcggtgttaacactgcttaagtccccgctttaatgctcgttcac
tccagccacgaagttcttaagtacaagttcactgcttctgaaatcacccatgccaccatt
aactaattcgttagtgactaccttgctggtaagctctcaacttacttgaagtctgaagat
atccctgccaccaacgacgaacccgtcaaggtcctcgtcggcaagagtttcgatgacctc
gtcattaacagcaacaaggatgtcttagttgaattctacgctccctggtgcggtcactgc
aagcaacttgctcccatctatgatgccgttgccaagaagctctcccacaaccacaacatc
gtcatcgctaagatcgattccaccgctaacgaagttcccggagtcaatattagaggtttc
cccaccattaagttctatcaaaacggtaagaaatctactcctcttgatttcgaaggtgac
agaactgaagaaggtatcctcaagtacctcaaggaaaagaccaccttcccttgggttgaa
aagaacgaagatctctga

DBGET integrated database retrieval system