KEGG   Tetrahymena thermophila: TTHERM_00483700Help
Entry
TTHERM_00483700   CDS       T01020                                 

Definition
L-asparaginase
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
tet  Tetrahymena thermophila
Brite
Enzymes [BR:tet01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     TTHERM_00483700
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     TTHERM_00483700
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     TTHERM_00483700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 636 aa AA seqDB search
MNQKLELEQQNSIHLHSQNSQSQERKKEFDKHQAVVFREKHNLECSQGLRIANQSRKVLI
ICTGGTISMFPTENGLAVKKGFFEKFLREDSYFCDSDYTYFHSSDGFLITPLTIYQQRIW
YKIYELENPIDSTNMNVIYYDQIASIIETNYTLYDSFIILHGTDTMAYTASALSFMLENL
SKTVILTGSQIPCSMMRNDGFNNLLCSLTIAGHYTIPEVLVCFNDKLFRGNRCTKMDSSA
MDSFDSPNFEPLATFKITIKIKWDKVLKRDPEKKFHVQKNLCDKIAIVKMHPFISSDTLK
AILTNKDTKAIIIETYGAGNIPINRPELMQMLQEAYDQGKVIVNLSQCYKSKVESIYETG
RALLKVGVLCGWDCTTEAMASKLAYLFSKNDSIENIRKNVQKNLRGELSPPIENDMFEFQ
QENFIQALNDALQYRTNEKIDILKNLILPNIVCYMSKGGFHQSMQQLKVYGIDFDKGDYD
NRTGLHLSAREGQLETVKFLIKECKNINTVDKFGRTALFEAVINRHHDVIVELQRAGGII
QAPKQEITSILMEAIRTGDQELFDLFHLGGLQDWNTFQTVDGRNLGHVAATFRQIEIIRF
LKYQCKFRFTDKDRWGKTALDEAKKRDFKEICKLLS
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaaaattagagttagaataatagaattctattcacttacattcccaaaattcc
taaagctaagaaaggaaaaaagaattcgataaacatcaagcagttgtctttagagaaaaa
cacaacttggaatgctctcaaggccttagaattgcaaactaaagtagaaaagtacttatt
atatgcacaggaggaacaatcagcatgtttccaacagaaaatgggttggctgtaaaaaag
ggtttcttcgaaaagtttcttagggaggattcctatttttgtgattcagattacacttat
tttcatagttctgatggttttttaataactcctttaactatttactagcaacgtatttgg
tataagatttatgaacttgagaatccaatagattcaactaatatgaatgttatatattat
gattaaattgcttcgataattgagacaaattatactttgtatgatagctttattatcttg
catggcacagacactatggcctacactgctagtgctttatcttttatgctagaaaattta
tcaaagacagttattttaaccggtagctaaattccatgctcgatgatgagaaacgacgga
ttcaacaatttactttgctctttgactattgcaggacattacactattcctgaggtttta
gtttgttttaatgataagctctttagaggtaatagatgcactaaaatggactcaagtgct
atggattcatttgattctccaaattttgaacctcttgctacttttaagataacaataaaa
ataaaatgggataaagtcttaaaaagagatcctgaaaagaaatttcatgtataaaaaaac
ttgtgcgataaaatagctattgttaaaatgcatcccttcataagttctgacactctaaaa
gctattcttactaataaagatactaaagcaatcataatagaaacatacggagcaggcaat
atcccaattaatagaccagagttgatgcaaatgctccaagaggcttatgactagggtaaa
gtaattgtaaatctctcttaatgctataaatcgaaagtagaatctatttatgaaacagga
agggctctattaaaggtaggagtgctttgtggctgggattgcactactgaggcaatggct
agtaaacttgcatatttattttctaagaatgattccatcgaaaacataaggaagaatgtt
taaaagaatttgagaggtgagttatctccaccaatcgaaaatgatatgtttgaatttcag
caggagaatttcatttaagctttaaatgatgcactttagtatagaacaaatgaaaaaatt
gatattttaaaaaatttgatactccctaatattgtttgctacatgagtaagggaggtttt
cattaaagcatgcagcagcttaaagtatatggcattgattttgataaaggagactatgac
aatagaacaggtttgcatctatctgcaagagaaggctaattagaaactgtcaaattttta
ataaaagaatgcaaaaatataaatacagtagacaagtttggaagaacagcattatttgaa
gcagtaataaatagacaccatgatgttatagttgagttatagagagcaggaggcataatt
taggctccgaagtaagaaataactagtatactaatggaagccatacgaactggagactaa
gaactttttgatttatttcacttaggaggtcttcaagattggaatactttctaaacagtt
gatggtagaaatttaggccatgttgcagccacttttagacaaatcgaaataataagattc
cttaaatactaatgcaaattcagatttacagataaagatagatggggaaagactgccttg
gatgaagcaaaaaaaagagattttaaagaaatatgcaagcttttatcttga

DBGET integrated database retrieval system