KEGG   Tetrahymena thermophila: TTHERM_00483700Help
Entry
TTHERM_00483700   CDS       T01020                                 

Definition
L-asparaginase
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
tet  Tetrahymena thermophila
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 636 aa AA seqDB search
MNQKLELEQQNSIHLHSQNSQSQERKKEFDKHQAVVFREKHNLECSQGLRIANQSRKVLI
ICTGGTISMFPTENGLAVKKGFFEKFLREDSYFCDSDYTYFHSSDGFLITPLTIYQQRIW
YKIYELENPIDSTNMNVIYYDQIASIIETNYTLYDSFIILHGTDTMAYTASALSFMLENL
SKTVILTGSQIPCSMMRNDGFNNLLCSLTIAGHYTIPEVLVCFNDKLFRGNRCTKMDSSA
MDSFDSPNFEPLATFKITIKIKWDKVLKRDPEKKFHVQKNLCDKIAIVKMHPFISSDTLK
AILTNKDTKAIIIETYGAGNIPINRPELMQMLQEAYDQGKVIVNLSQCYKSKVESIYETG
RALLKVGVLCGWDCTTEAMASKLAYLFSKNDSIENIRKNVQKNLRGELSPPIENDMFEFQ
QENFIQALNDALQYRTNEKIDILKNLILPNIVCYMSKGGFHQSMQQLKVYGIDFDKGDYD
NRTGLHLSAREGQLETVKFLIKECKNINTVDKFGRTALFEAVINRHHDVIVELQRAGGII
QAPKQEITSILMEAIRTGDQELFDLFHLGGLQDWNTFQTVDGRNLGHVAATFRQIEIIRF
LKYQCKFRFTDKDRWGKTALDEAKKRDFKEICKLLS
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaaaattagagttagaataatagaattctattcacttacattcccaaaattcc
taaagctaagaaaggaaaaaagaattcgataaacatcaagcagttgtctttagagaaaaa
cacaacttggaatgctctcaaggccttagaattgcaaactaaagtagaaaagtacttatt
atatgcacaggaggaacaatcagcatgtttccaacagaaaatgggttggctgtaaaaaag
ggtttcttcgaaaagtttcttagggaggattcctatttttgtgattcagattacacttat
tttcatagttctgatggttttttaataactcctttaactatttactagcaacgtatttgg
tataagatttatgaacttgagaatccaatagattcaactaatatgaatgttatatattat
gattaaattgcttcgataattgagacaaattatactttgtatgatagctttattatcttg
catggcacagacactatggcctacactgctagtgctttatcttttatgctagaaaattta
tcaaagacagttattttaaccggtagctaaattccatgctcgatgatgagaaacgacgga
ttcaacaatttactttgctctttgactattgcaggacattacactattcctgaggtttta
gtttgttttaatgataagctctttagaggtaatagatgcactaaaatggactcaagtgct
atggattcatttgattctccaaattttgaacctcttgctacttttaagataacaataaaa
ataaaatgggataaagtcttaaaaagagatcctgaaaagaaatttcatgtataaaaaaac
ttgtgcgataaaatagctattgttaaaatgcatcccttcataagttctgacactctaaaa
gctattcttactaataaagatactaaagcaatcataatagaaacatacggagcaggcaat
atcccaattaatagaccagagttgatgcaaatgctccaagaggcttatgactagggtaaa
gtaattgtaaatctctcttaatgctataaatcgaaagtagaatctatttatgaaacagga
agggctctattaaaggtaggagtgctttgtggctgggattgcactactgaggcaatggct
agtaaacttgcatatttattttctaagaatgattccatcgaaaacataaggaagaatgtt
taaaagaatttgagaggtgagttatctccaccaatcgaaaatgatatgtttgaatttcag
caggagaatttcatttaagctttaaatgatgcactttagtatagaacaaatgaaaaaatt
gatattttaaaaaatttgatactccctaatattgtttgctacatgagtaagggaggtttt
cattaaagcatgcagcagcttaaagtatatggcattgattttgataaaggagactatgac
aatagaacaggtttgcatctatctgcaagagaaggctaattagaaactgtcaaattttta
ataaaagaatgcaaaaatataaatacagtagacaagtttggaagaacagcattatttgaa
gcagtaataaatagacaccatgatgttatagttgagttatagagagcaggaggcataatt
taggctccgaagtaagaaataactagtatactaatggaagccatacgaactggagactaa
gaactttttgatttatttcacttaggaggtcttcaagattggaatactttctaaacagtt
gatggtagaaatttaggccatgttgcagccacttttagacaaatcgaaataataagattc
cttaaatactaatgcaaattcagatttacagataaagatagatggggaaagactgccttg
gatgaagcaaaaaaaagagattttaaagaaatatgcaagcttttatcttga

DBGET integrated database retrieval system