KEGG   Tetrahymena thermophila: TTHERM_00509030Help
Entry
TTHERM_00509030   CDS       T01020                                 

Definition
(RefSeq) cytochrome C class I protein
Organism
tet  Tetrahymena thermophila
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-GeneID: 7844229
NCBI-ProteinID: XP_001015207
TGD: TTHERM_00509030
UniProt: I7M154
AA seq 285 aa AA seqDB search
MNGRLHELNIQTQQFFTNILSFILVLSNLLIDKFIWIQLRQQSFHQKIQLKNASAKDIIS
KQISQSSFNQLLIKGNKQTLLKKQTKKNLINYQHQKNLIKQLKEKQINQQKMSSNSSSGN
SGYYGSSTAVNSNIAQNGGKNNVQKLGEHKYTTRKFFVPPDRDDIDIPDGDPLRGEIIYK
NGCMGCHELDEDTCMGPSMRWVYMRKAGVSKNFRGYSSLMPSGKFYWNRNSLDQFLEDPE
KMFPDTNMAFYGMKDPFERACLIEYLHYLRVGTDGAQRQPKTFVL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaagattgcatgaattaaatatataaacttaataattctttactaatatccta
tcattcattttagtattaagtaatttattgattgataaatttatttggatttagttaaga
tagcaatcattccatcaaaaaatttaattaaaaaatgcaagtgcaaaagatattattagt
aagtaaataagtcagtcctctttcaattaattgttaataaaaggaaataaataaactcta
cttaaaaagcaaacaaaaaaaaatttaattaattatcagcattaaaaaaatttaataaag
taattaaaagaaaagcaaattaattaacaaaaaatgagttcaaacagttcaagcggtaat
tccggctattatggaagtagtactgcagttaatagcaatatagcataaaatggaggaaaa
aataatgtttaaaaattgggagagcataaatataccacaagaaagtttttcgtacctcct
gacagagacgacatcgatattcctgatggcgatcctttaagaggtgaaattatctataaa
aacggttgcatgggttgtcatgagttagatgaagatacttgtatgggtccctctatgcgt
tgggtctacatgagaaaggcaggtgttagtaaaaacttcagaggttactcttctctcatg
ccctccggcaagttctactggaacagaaattctttggattagttcctcgaagaccctgaa
aaaatgttccctgatactaatatggctttttacggtatgaaggatccctttgagagagcc
tgcttaattgaatacttgcattacttgagagttggtacagatggagcctaacgtcaacct
aaaacttttgttttgtga

DBGET integrated database retrieval system