KEGG   Tetrahymena thermophila: TTHERM_00509030Help
Entry
TTHERM_00509030   CDS       T01020                                 

Definition
(RefSeq) cytochrome C class I protein
Organism
tet  Tetrahymena thermophila
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TGD: 
UniProt: 
AA seq 285 aa AA seqDB search
MNGRLHELNIQTQQFFTNILSFILVLSNLLIDKFIWIQLRQQSFHQKIQLKNASAKDIIS
KQISQSSFNQLLIKGNKQTLLKKQTKKNLINYQHQKNLIKQLKEKQINQQKMSSNSSSGN
SGYYGSSTAVNSNIAQNGGKNNVQKLGEHKYTTRKFFVPPDRDDIDIPDGDPLRGEIIYK
NGCMGCHELDEDTCMGPSMRWVYMRKAGVSKNFRGYSSLMPSGKFYWNRNSLDQFLEDPE
KMFPDTNMAFYGMKDPFERACLIEYLHYLRVGTDGAQRQPKTFVL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaagattgcatgaattaaatatataaacttaataattctttactaatatccta
tcattcattttagtattaagtaatttattgattgataaatttatttggatttagttaaga
tagcaatcattccatcaaaaaatttaattaaaaaatgcaagtgcaaaagatattattagt
aagtaaataagtcagtcctctttcaattaattgttaataaaaggaaataaataaactcta
cttaaaaagcaaacaaaaaaaaatttaattaattatcagcattaaaaaaatttaataaag
taattaaaagaaaagcaaattaattaacaaaaaatgagttcaaacagttcaagcggtaat
tccggctattatggaagtagtactgcagttaatagcaatatagcataaaatggaggaaaa
aataatgtttaaaaattgggagagcataaatataccacaagaaagtttttcgtacctcct
gacagagacgacatcgatattcctgatggcgatcctttaagaggtgaaattatctataaa
aacggttgcatgggttgtcatgagttagatgaagatacttgtatgggtccctctatgcgt
tgggtctacatgagaaaggcaggtgttagtaaaaacttcagaggttactcttctctcatg
ccctccggcaagttctactggaacagaaattctttggattagttcctcgaagaccctgaa
aaaatgttccctgatactaatatggctttttacggtatgaaggatccctttgagagagcc
tgcttaattgaatacttgcattacttgagagttggtacagatggagcctaacgtcaacct
aaaacttttgttttgtga

DBGET integrated database retrieval system