KEGG   Tetrahymena thermophila: TTHERM_00530750Help
Entry
TTHERM_00530750   CDS       T01020                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase family protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tet  Tetrahymena thermophila
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:tet01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tet00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tet00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tet00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 628 aa AA seqDB search
MISSTRLLKRASNYLKQAARYSMSTVQKGKKTSFKAPLYQINFQSQSLSQNITYNFSSYP
KHRLVALPALSPTMTEGKIAAWHIKVGQKIQEGDNIFDVQTDKDSVPNVYQEETGFVAKI
LVNEGELIPANTPVVVVCKSEADIPAFANFTVGGAQKAQEAPKQEQPKPAAQTAAKPAPA
ASSGASFPKHNVVLLPALSPTMTEGKIASFHVKVGDKVTEGDNIFDVQTDKDSVPNIYQE
ASGFVAKILVKEGETIPANHPVLVVVAKKDDLAKFEQFTLNDALKKGSASSAPQEAAQPA
QTSSAQTATQTTVASGSSGRVAASPYAKTVAQEKGVDLSTVQGSGPNGRIIAKDVQNATT
KAAQQTVAAQQPAAETKQEAPKPAPQQPKVEVVVQGGVEYQKIPITPMRKTIAERLVQSK
TTVPHFYLNIDVQMDEVLHLRKTLNEQSTSKISVNDLIVKASALALRDMPGVNSQWHGDH
IRQFKHADVAVAVSTKTGLITPIVFNAETLGLSQISSKTKELAEKARKGGLLPTEYQGGT
FTISNLGMYGIDHFAAIVNPPHGTILAVGATSQKVVPDNDPHAKYPFKTIQSMTVTLSCD
HRVVDGALGAEWLQKFKGYLEKPYTMLL
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgatttcttcaactagacttttaaagagagcttctaactacttaaagcaagctgcccgt
tattcaatgtccacagtttaaaagggcaaaaagacttccttcaaggcacctctctatcaa
atcaatttctaatcctaatctttgtcatagaatattacctacaacttctcaagttatcct
aagcatagacttgtcgctttacctgctctctctcctaccatgactgaaggtaaaattgca
gcctggcacatcaaggttggctaaaagatctaagaaggtgataatatcttcgatgtctaa
actgataaagactctgtaccaaatgtttaccaagaagaaactggttttgttgccaagata
ttggtcaacgaaggtgaattgattcctgctaacactccagtcgttgttgtttgtaagtct
gaagctgatattcctgcctttgctaacttcactgtaggtggagcccaaaaggcttaggaa
gcccctaagtaagaatagcccaagcctgctgcctagacagctgctaagcctgctcctgct
gcctcttctggtgcttcattccctaagcataatgtcgtccttcttcccgccttatctcct
accatgactgaaggtaaaatagcttccttccatgtaaaagttggagataaagtcactgaa
ggtgacaacattttcgatgtttaaactgataaagactcagtcccaaatatttactaagaa
gcatcaggatttgttgctaaaattttagttaaggaaggtgaaacaatccctgccaaccat
cctgttttagttgttgtcgccaaaaaagacgatcttgctaagtttgaataattcacatta
aatgatgctttgaaaaagggttctgcttcttctgccccctaagaagctgctcaacctgct
caaacttcttctgcttaaactgccacataaactaccgttgcttctggatcttctggaaga
gttgctgctagtccttatgctaaaactgttgcttaagaaaagggagttgatctttcaact
gtttaaggttctggtcctaatggccgtattattgccaaggacgtataaaatgctacaact
aaagctgctcaataaactgttgctgcttaataacctgctgctgaaaccaaataggaagct
cctaaacctgctccttaataacctaaggtagaagttgttgtttaaggaggtgttgaatat
caaaagattccaattactcctatgagaaaaacaattgctgaacgtttggtctaatctaag
acaactgttcctcacttctatttaaatattgatgtttaaatggacgaagttcttcattta
cgtaaaactttaaatgaacaatctacttctaagatctcagtcaatgacttaattgttaag
gctagtgctttagctcttagagatatgccaggagtcaattcccaatggcacggtgatcac
attcgtcaattcaagcatgctgatgttgctgttgcagtatcaactaagactggtttgatt
actcctattgtttttaatgctgaaactttgggactttcttaaatctcttctaagactaaa
gagttagctgaaaaggctagaaagggaggacttcttcctactgaatattaaggtggtact
ttcactatctctaacttgggtatgtatggtattgaccatttcgcagctattgttaatcct
cctcatggtactattttagctgttggtgctacttcataaaaggttgtccctgacaatgat
cctcatgctaaatatcctttcaagactatttaatcaatgactgtaactttaagttgcgat
catagagtagtcgatggtgctcttggtgccgaatggttacaaaaattcaaaggttacctc
gaaaagccttacactatgcttctttga

DBGET integrated database retrieval system