KEGG   Tetrahymena thermophila: TTHERM_00532330Help
Entry
TTHERM_00532330   CDS       T01020                                 

Definition
ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain containing protein (EC:3.1.1.61)
Organism
tet  Tetrahymena thermophila
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
AA seq 1211 aa AA seqDB search
MIITPKKPQNILSVGDLEVKYVNNCFLNQFNIQASEALSILPLIHASKLKNANDNEVNRF
SIKDSVQIKQQTTENDIQKEVIPHSIKDIKAEIQISNQQNNLLNNFIAKTNQNQIKPMLK
IHKLPQSTDYKQLNEQGPQDLNSVAESTNIIQEEKGDQVHNLPKPLKSNKRSGFDNYTNF
PSSIQHSFNISSQTEHNSQNILVSVNKLNNQSLEPKNGINKSDKFQSADCIQQNENQQEK
IKLQLNINKDQSSNKKELNFFKISNQNSSLQQFNEIVINTNKISAKQNQGSTLTNREGSS
RAINIPTSRNRIESFNKNKGSSFQNSPGLACGDNVITLLDKINYYHQKYLQHKEKSLSFS
QRNIIDDSQYKQSLVIWEYRKDDKNLSQEQKNRSNNQYPSNQKIGSIPETQKQLRFQSIN
NILQINDDKIENNNQIFSQNENVQQNTSTSVEQALRNAQIKINQNQNNEIQITKSNHTNT
EHEQDNDIHEYANQPLESDKINPDNNFINLKSDKNGQYFNKQDNYEVKPQAYQNTTLIPS
TFQKKAAQKIQTQYPSNLENTDTYNNIRSPSMSQRITQFTTQTNNIQENQNKQNKSVRRI
SNNGHNLVAKKIDENILEITREQKVKSNVNNNQIDQGEQINKSKVDDDEDEEGDDRRYLE
IKLFECEMDKEESIMLIVNNINQRIKYERLKEAQMKNQQMLANVTHDLKTPLNCITLMVE
GMKLEKQYNEQTINMILENSNLLMCLIQDILDYSQIKKGKLRLVQQYFYVSEIIQEVINL
FQMQADQKNIKLISNIYRSSNSSVNTSSNYNNNNLGLNTANQYLNVYNAPSQPILIHQQL
IQTNRNHNNSLVTNNEMQSQVNMNEQTKNIHMHQDKNRIKQILINLISNALKFTTEGYIE
ISCEIKDLEENSNIKIVEFSVKDTGVGMNPHIKSQLFKVFNTFDQKGLNKNGIGLGLTIC
KRLVTFLGPSDHIDVESEVSKGSKFTFKVYKDLRDINNTHHSLSDESDESPDINSKSVFH
DLAKSIKKNYTLKEEDQIEDSQLLVNSLPCSNAHPNIKQLYEKDSLVKAINTEDTPKSAD
VQNQFSMLIVDDQPFNIMAFKIVLKNFKQITITEAYNGKDAFEKFQKQKFDFVLMDYNMP
IMNGYESTKLIRMYEQQNNLVPSKIIIVSGFDEKQKEYQKAMLGGADDFLTKPVNFKIIT
EKLNSYMSKIN
NT seq 3636 nt NT seq  +upstreamnt  +downstreamnt
atgataattactcctaaaaaacctcagaacattctttctgtaggtgacttagaggtgaag
tatgtaaataattgctttcttaatcaattcaatatttaagcctctgaagctcttagcatt
cttcctcttattcatgcaagcaaattaaaaaatgctaatgataatgaagtaaatagattt
agtattaaagactctgtctaaataaagcaacaaacaacagaaaatgatatttaaaaagaa
gttattccacattccataaaagatataaaagctgaaatataaatatcaaactaataaaat
aatctactgaacaattttatagcaaaaactaattagaattaaataaaacctatgctaaaa
atacataaattacctcaaagcacagattacaagtaattaaatgaacaggggccacaggat
ttaaacagtgtagctgaatcaacaaacattatttaagaagaaaaaggagattaagtacat
aatttacctaaaccactcaaaagtaataaaagaagtggatttgataattatactaatttt
ccttcaagcattcagcatagctttaatatttcctcttaaacagaacacaattctcaaaat
attttagtaagcgtaaataaattaaataattaaagcttagaacctaaaaatggtatcaat
aaaagtgataaattttagtcagccgattgtatttaataaaacgaaaattaataagaaaaa
attaaattgtaattgaatataaataaagaccagtcttcaaataaaaaagaactaaatttc
tttaagatttcaaatcaaaattcaagcttgtaatagtttaatgaaatagttatcaatacc
aataaaatttcagcaaaataaaactaaggcagcacattaacaaatagagaaggtagcagc
agagcaattaacattcctacttctagaaataggatagagagttttaataaaaataaaggt
agttctttttaaaattcaccaggtttagcttgtggtgataacgtgattacactattagat
aagattaattattaccactaaaaatacttgcagcacaaagaaaagagcttatctttttct
caaagaaatatcatagatgactcttaatataaacagtctttagtgatttgggaatataga
aaagatgataaaaacctatcttaggaataaaaaaatagaagtaataattaatatccttca
aatcaaaaaattggaagcataccagaaacttaaaaacagttaaggttctagtcaattaat
aatattttacaaattaatgatgataaaatagaaaataataattaaatattctcataaaat
gaaaatgtttaacagaatacaagtacttctgtcgaataagctttaagaaatgcttagatc
aaaataaattaaaattaaaataatgaaatacaaattaccaaaagtaatcatactaacact
gagcatgaacaggataatgatattcatgaatatgctaattaaccacttgaaagcgataaa
ataaaccctgataacaattttattaacttgaaatctgacaaaaatggttaatatttcaat
aaataagacaattatgaagttaaaccttaagcttattaaaatacaactttgattccatct
acctttcaaaaaaaggctgctcaaaagatataaactcaatatccttctaacttagaaaac
actgatacttataacaatattagaagtccatccatgagttaaaggataactcaattcaca
acacaaaccaataacatctaagaaaattaaaataagtaaaacaagagtgtcagaagaatt
tcaaacaacggtcataatcttgtagcaaaaaaaatcgatgagaacattttagaaattaca
agagagtaaaaagttaaaagtaatgtaaataacaattaaatagattaaggagagcaaata
aataaaagcaaagtcgatgatgatgaagatgaagaaggggatgacagacgatatctcgaa
ataaaattatttgaatgcgagatggataaagaagaatcaataatgctgattgtaaataat
attaattagaggataaaatatgaaagactaaaggaagcatagatgaaaaattaataaatg
cttgccaacgtaacacatgatctaaaaactcctcttaactgtataaccttgatggttgaa
ggaatgaaattagaaaaatagtataatgaataaacaattaatatgattctagagaattcc
aatcttctcatgtgtttgatttaagatatactagactactcttagatcaaaaaaggaaaa
cttcgtcttgtctaataatatttttatgtttctgaaattattcaggaagttatcaatctc
ttctaaatgtaagcagattaaaaaaatattaaattaatctcaaatatttatcgttcaagc
aattcttctgtaaatacaagctcgaattataacaacaacaatttaggattaaatactgct
aatcaatatctgaatgtctataacgctccaagccagccaatcctaattcattaataattg
attcaaacaaatagaaatcataacaactctttagtaactaataatgagatgcaaagttaa
gtcaatatgaatgaatagactaaaaatattcatatgcattaagataaaaataggattaag
caaattttaattaatttgataagcaatgccttgaaatttactacagagggttacattgaa
ataagctgtgaaataaaagatctagaagaaaattccaatatcaaaatagttgaattttcg
gttaaagacacgggagttggtatgaatcctcatattaagtctcaactcttcaaggttttt
aatactttcgattaaaaaggtctgaataagaatggaataggtttaggattgacaatatgt
aaaaggctagttacttttctaggaccatcagatcatattgatgtagaatcagaagtttca
aaaggatctaaatttacatttaaggtctacaaagatctgagagatatcaataacactcat
cactcattatcagatgagtctgatgaatccccagatattaatagcaaatctgtattccac
gatctagctaaaagcattaaaaaaaattatactttaaaagaagaagattaaatagaagat
tcctaactacttgttaattcactcccttgttctaatgcacacccaaatataaaatagctc
tatgaaaaagatagccttgttaaagcaataaacactgaagatacacctaaatctgctgat
gtttaaaactaatttagtatgctaatcgtagatgatcaaccatttaatattatggcattt
aagatagtcctaaaaaattttaagcaaataacaatcacagaagcatataatggcaaagat
gcctttgaaaagttttaaaaataaaagtttgactttgtgttaatggattacaacatgcct
attatgaatggatatgagtcaacaaagctcattaggatgtatgaatagcaaaataaccta
gttccttcgaagattataatagtgtctggatttgatgaaaagtaaaaggagtattaaaaa
gcaatgttaggtggcgctgacgattttttaacaaagcctgttaattttaagataataaca
gaaaaacttaattcttacatgagtaagattaattga

DBGET integrated database retrieval system