KEGG   Tetrahymena thermophila: TTHERM_00566660Help
Entry
TTHERM_00566660   CDS       T01020                                 

Definition
Aldose 1-epimerase family protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
tet  Tetrahymena thermophila
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTHERM_00566660
   00052 Galactose metabolism
    TTHERM_00566660
Enzymes [BR:tet01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     TTHERM_00566660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 349 aa AA seqDB search
MQIEQTLFGKIGEESIWKFTFSNKKGTKVSVINYGAIITEIQTLDKQNQLANIVLNFDDF
TQYHLHNDAYFGAFVGRCANRIANGKFSLSNDPNHVYQLAVNNGPNHLHGGIKGFDKKIY
QFQIQQPNQLILTGVSEDGEEGYPGKLEIQIKYELNDENEFQMIFTSQTDKQTLCNLTSH
SYFNLQTKKDFATCMQDHSLFINADFYTPLDDTCCPYGEILKVQNTPFDFTQQKTLQEQL
SQQGKDNQLQIGNGLDHNFILKRSGKINLAAKVQEKASGRVLEVYTNQPGLQLYTGNYLS
QIKGFVDRAGFCLETQGIPNSINIPHFPQVELLPGQTHEHITLYKFSTI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtaaatagagtaaacactttttggtaagattggtgaggaatcaatctggaaatttaca
ttttcaaataagaaaggtactaaagtgagtgtaataaattatggagcaattattacagaa
atacaaactcttgataaataaaatcaattagcaaatatagtacttaattttgatgatttt
acataatatcatttacataatgatgcttactttggcgcctttgttggaagatgcgccaat
agaattgcaaatgggaaattttctttgagcaacgaccctaatcatgtttattagctagct
gtaaataatgggccaaatcatctccatggtggaatcaaaggatttgataaaaagatttat
taattctaaatttaataacctaattagttaattcttactggagtgagtgaagatggagag
gaaggctacccaggaaaactagaaatttaaattaaatatgaattaaatgacgaaaatgag
ttctaaatgatatttacttcctaaacagataagtaaactctttgcaatttaactagtcat
agctatttcaatctttagacaaagaaagattttgcaacttgcatgtaagatcattcactt
ttcataaatgcagatttttatactcctttagatgatacatgttgcccatatggtgaaatt
ttaaaagtttaaaatacaccatttgatttcacataatagaaaacactttaagaatagtta
tcttagcaaggcaaagataatcaattataaatcggtaatggattagatcataactttatt
ctcaaaagatctggaaaaatcaatttagctgctaaagtttaagaaaaagcatctggtaga
gtactggaagtgtatacaaactagcctggattataattatatacaggtaattacttaagc
taaatcaaaggatttgtagatagagctggattttgtctagagacacaaggaatacctaac
tcaattaacattcctcacttcccataagtagaactcttacctggataaactcatgagcat
ataactttatataagtttagtacaatctga

DBGET integrated database retrieval system