KEGG   Tetrahymena thermophila: TTHERM_00571980Help
Entry
TTHERM_00571980   CDS       T01020                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tet  Tetrahymena thermophila
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tet00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TTHERM_00571980
   01230 Biosynthesis of amino acids
    TTHERM_00571980
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TTHERM_00571980
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TTHERM_00571980
Enzymes [BR:tet01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TTHERM_00571980
Exosome [BR:tet04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TTHERM_00571980
  Exosomal proteins of melanoma cells
   TTHERM_00571980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
TGD: 
UniProt: 
AA seq 255 aa AA seqDB search
MSSESKYKVVFVRHGQSEWNLKNIFTGWHDIPLSEQGHQEATLAGQILKQKGYSFDLAIT
SVLQRSIQTFNHIAEELQIHHIPIIKSWRLNERHYGSLQGLNKSETAALHGEAQVKIWRR
SYDVRPPEMSIDHPDYPGKDSRYKHIPPSSLPKGECLKDTVERVLPFWTDTICKAIIEGQ
KVIVSAHGNSLRAIVKYLDKMTDEQIMELDIPTGVPLVYELDENLLPVKHYYLISQEELE
KKMQEVKNQGKAQQN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagttcagaaagtaaatacaaagttgtgtttgttcgtcacggttagagcgaatggaat
cttaaaaatatatttacaggctggcatgatattccattatcagagcaaggtcatcaagaa
gctactcttgcaggataaattttaaaatagaaaggttatagttttgatttagcaataaca
agtgtcctacaaagatctatttagacattcaatcacatagcagaagaattataaattcat
catattcctattataaaatcttggagacttaatgaaagacactatggctctttacaaggc
ttaaataaatctgaaacagctgcattacatggagaagcctaagtcaaaatctggagaaga
tcatatgacgtgagacctcctgaaatgtccatagatcatccagattacccaggtaaggat
tcaagatacaagcatataccaccctcaagcttaccaaaaggagaatgcttgaaagatact
gtagaaagagtacttcctttctggactgatactatatgtaaagcaattattgagggtcaa
aaagtaatcgtttcagctcatggaaattctcttagagccattgttaagtatttagataag
atgactgatgaataaattatggaattagacatacctactggagttcctttagtttatgag
cttgacgaaaatcttctcccagttaagcattactatttgatctcataggaagagttagaa
aagaagatgcaagaagtcaagaatcaaggaaaagctcaataaaattga

DBGET integrated database retrieval system